Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1032870435-012785-11441 Query= gi|16763661|ref|NP_459276.1| putative periplasmic protein [Salmonella typhimurium LT2] (127 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,172,300 sequences; 371,327,854 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports Score E Sequences producing significant alignments: (bits) Value ref|NP_459276.1| (NC_003197) putative periplasmic protein [... 244 5e-65 ref|NP_405138.1| (NC_003143) putative exported protein [Yer... 59 3e-09 ref|NP_669919.1| (NC_004088) hypothetical [Yersinia pestis ... 59 3e-09 gb|ZP_00083414.1| (NZ_AABA01000072) hypothetical protein [P... 31 0.86 ref|NP_661687.1| (NC_002932) AslB/AtsB family protein [Chlo... 30 1.5 dbj|BAC00968.1| (AB086390) ABC-type transporter periplasmic... 30 1.6 ref|NP_484520.1| (NC_003272) hypothetical protein [Nostoc s... 29 3.2 pir||H35905 hypothetical protein 1 (Sm1) - Streptococcus mu... 29 3.8 gb|ZP_00091876.1| (NZ_AAAD01000090) hypothetical protein [A... 29 3.9 ref|NP_486920.1| (NC_003272) bicarbonate transport ATP-bind... 28 4.9 gb|ZP_00105962.1| (NZ_AABC01000058) hypothetical protein [N... 28 4.9 gb|ZP_00079868.1| (NZ_AAAS01000002) hypothetical protein [G... 28 5.5 gb|ZP_00092565.1| (NZ_AAAD01000091) hypothetical protein [A... 28 5.7 gb|ZP_00085892.1| (NZ_AABA01000138) hypothetical protein [P... 28 5.7 pir||S46920 transcription repressor - Mycoplasma capricolum... 28 5.7 ref|NP_249846.1| (NC_002516) ribonucleoside reductase, smal... 28 6.7 ref|NP_224077.1| (NC_000921) putative [Helicobacter pylori ... 28 7.1 gb|ZP_00065184.1| (NZ_AAAT01000002) hypothetical protein [M... 28 7.1 Alignments
RID: 1032870435-012785-11441
Query= gi|16763661|ref|NP_459276.1| putative periplasmic protein [Salmonella typhimurium LT2] (127 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,172,300 sequences; 371,327,854 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value ref|NP_459276.1| (NC_003197) putative periplasmic protein [... 244 5e-65 ref|NP_405138.1| (NC_003143) putative exported protein [Yer... 59 3e-09 ref|NP_669919.1| (NC_004088) hypothetical [Yersinia pestis ... 59 3e-09 gb|ZP_00083414.1| (NZ_AABA01000072) hypothetical protein [P... 31 0.86 ref|NP_661687.1| (NC_002932) AslB/AtsB family protein [Chlo... 30 1.5 dbj|BAC00968.1| (AB086390) ABC-type transporter periplasmic... 30 1.6 ref|NP_484520.1| (NC_003272) hypothetical protein [Nostoc s... 29 3.2 pir||H35905 hypothetical protein 1 (Sm1) - Streptococcus mu... 29 3.8 gb|ZP_00091876.1| (NZ_AAAD01000090) hypothetical protein [A... 29 3.9 ref|NP_486920.1| (NC_003272) bicarbonate transport ATP-bind... 28 4.9 gb|ZP_00105962.1| (NZ_AABC01000058) hypothetical protein [N... 28 4.9 gb|ZP_00079868.1| (NZ_AAAS01000002) hypothetical protein [G... 28 5.5 gb|ZP_00092565.1| (NZ_AAAD01000091) hypothetical protein [A... 28 5.7 gb|ZP_00085892.1| (NZ_AABA01000138) hypothetical protein [P... 28 5.7 pir||S46920 transcription repressor - Mycoplasma capricolum... 28 5.7 ref|NP_249846.1| (NC_002516) ribonucleoside reductase, smal... 28 6.7 ref|NP_224077.1| (NC_000921) putative [Helicobacter pylori ... 28 7.1 gb|ZP_00065184.1| (NZ_AAAT01000002) hypothetical protein [M... 28 7.1
>ref|NP_459276.1| (NC_003197) putative periplasmic protein [Salmonella typhimurium LT2] gb|AAL19235.1| (AE008707) putative periplasmic protein [Salmonella typhimurium LT2] Length = 127 Score = 244 bits (623), Expect = 5e-65 Identities = 127/127 (100%), Positives = 127/127 (100%) Query: 1 MDTAVKWLILVTFSISGMLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKN 60 MDTAVKWLILVTFSISGMLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKN Sbjct: 1 MDTAVKWLILVTFSISGMLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKN 60 Query: 61 DARATASAYLEYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNEL 120 DARATASAYLEYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNEL Sbjct: 61 DARATASAYLEYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNEL 120 Query: 121 IKRRVEK 127 IKRRVEK Sbjct: 121 IKRRVEK 127
>ref|NP_405138.1| (NC_003143) putative exported protein [Yersinia pestis] emb|CAC90375.1| (AJ414149) putative exported protein [Yersinia pestis] Length = 144 Score = 59.3 bits (142), Expect = 3e-09 Identities = 41/114 (35%), Positives = 59/114 (50%), Gaps = 7/114 (6%) Query: 12 TFSISGM--LVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAY 69 T SI+ + L+ + A E + Q L+N+ALS CLA + D + ++A + AY Sbjct: 25 TLSITSLIFLISFSTLAAEVNQNKVQQKNNLENFALSICLAEGFPDGEINSEAFSAVGAY 84 Query: 70 LEYGKQSVEIYHEIDEIAKKYSGLKY---NGSISSDFNTMKCIDFIHDRELNEL 120 +E G VE Y E+ E+AKK+ KY NG S MKCID EL+ + Sbjct: 85 VELGAYPVEAYEEVSELAKKFLEKKYISKNG--ESKLTVMKCIDLSQSSELSAI 136
>ref|NP_669919.1| (NC_004088) hypothetical [Yersinia pestis KIM] gb|AAM86170.1|AE013863_4 (AE013863) hypothetical [Yersinia pestis KIM] Length = 136 Score = 59.3 bits (142), Expect = 3e-09 Identities = 41/114 (35%), Positives = 59/114 (50%), Gaps = 7/114 (6%) Query: 12 TFSISGM--LVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAY 69 T SI+ + L+ + A E + Q L+N+ALS CLA + D + ++A + AY Sbjct: 17 TLSITSLIFLISFSTLAAEVNQNKVQQKNNLENFALSICLAEGFPDGEINSEAFSAVGAY 76 Query: 70 LEYGKQSVEIYHEIDEIAKKYSGLKY---NGSISSDFNTMKCIDFIHDRELNEL 120 +E G VE Y E+ E+AKK+ KY NG S MKCID EL+ + Sbjct: 77 VELGAYPVEAYEEVSELAKKFLEKKYISKNG--ESKLTVMKCIDLSQSSELSAI 128
>gb|ZP_00083414.1| (NZ_AABA01000072) hypothetical protein [Pseudomonas fluorescens] Length = 158 Score = 31.2 bits (69), Expect = 0.86 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Query: 26 AQEALTTQYSQSELLKNWALSHCLALVYKD-DVVKNDARATASAYLEYGK 74 A E T Q Q+ LKN+ LSHC+ +K+ +K D +A AY GK Sbjct: 40 ASEGRTEQARQN--LKNYGLSHCILAPFKEHSAMKKDIELSAGAYSFMGK 87
>ref|NP_661687.1| (NC_002932) AslB/AtsB family protein [Chlorobium tepidum TLS] gb|AAM72029.1| (AE012847) AslB/AtsB family protein [Chlorobium tepidum TLS] Length = 394 Score = 30.4 bits (67), Expect = 1.5 Identities = 13/41 (31%), Positives = 23/41 (55%), Gaps = 7/41 (17%) Query: 77 VEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDREL 117 ++ Y ++D + KKY+ Y NT++ ++HDREL Sbjct: 81 IDFYRKVDRLQKKYATKPYA-------NTIQTSGYVHDREL 114
>dbj|BAC00968.1| (AB086390) ABC-type transporter periplasmic sulfonate-binding component [Pseudomonas putida] Length = 323 Score = 30.4 bits (67), Expect = 1.6 Identities = 29/90 (32%), Positives = 38/90 (42%), Gaps = 10/90 (11%) Query: 15 ISGMLVWQPSF--AQEALTTQYSQSELLKNWALSHCLALVYKD------DVVKNDARATA 66 I VW P+ A+E + EL K A + +V KD DVVK A+ T Sbjct: 172 IDATYVWDPALGVAKENGKVLITSGELAKKGAPTFDAWIVRKDFAAKHPDVVKAFAKVTL 231 Query: 67 SAYLEYGKQSVEIYHEIDEIAK--KYSGLK 94 AY +Y K D ++K K SG K Sbjct: 232 DAYADYRKNPQAWLANPDNVSKLAKLSGAK 261
>ref|NP_484520.1| (NC_003272) hypothetical protein [Nostoc sp. PCC 7120] dbj|BAB72434.1| (AP003582) ORF_ID:all0476~hypothetical protein [Nostoc sp. PCC 7120] Length = 274 Score = 29.3 bits (64), Expect = 3.2 Identities = 12/31 (38%), Positives = 19/31 (60%) Query: 7 WLILVTFSISGMLVWQPSFAQEALTTQYSQS 37 WLIL S+ + +WQP+ A E T+ +Q+ Sbjct: 20 WLILCILSLGLVNIWQPTQAIEVAQTRTTQN 50
>pir||H35905 hypothetical protein 1 (Sm1) - Streptococcus mutans (fragment) Length = 159 Score = 28.9 bits (63), Expect = 3.8 Identities = 16/56 (28%), Positives = 27/56 (47%) Query: 43 WALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIAKKYSGLKYNGS 98 W SH L L + D V A A A + + +S I ++ E +K++ + NG+ Sbjct: 4 WQTSHWLFLFFGADSVGKTELAKALAEVLFDDESALIRFDMSEYMEKFAASRLNGA 59
>gb|ZP_00091876.1| (NZ_AAAD01000090) hypothetical protein [Azotobacter vinelandii] Length = 517 Score = 28.9 bits (63), Expect = 3.9 Identities = 26/107 (24%), Positives = 45/107 (41%), Gaps = 7/107 (6%) Query: 21 WQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIY 80 + PS+A+ L +Q S S L L + V + A A AYL + + Sbjct: 147 YNPSYAEMGLRSQVSGSVDLD-------LEALIDRKVYRFMGDAAAFAYLSMEQAIKDAG 199 Query: 81 HEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK 127 ++I+ GL +S FN M+ +D + D+ + + RV + Sbjct: 200 LTAEQISDPRVGLIAGSGGASTFNQMEAMDILRDKGVKRVGPYRVPR 246
>ref|NP_486920.1| (NC_003272) bicarbonate transport ATP-binding protein [Nostoc sp. PCC 7120] dbj|BAB74579.1| (AP003591) bicarbonate transport ATP-binding protein [Nostoc sp. PCC 7120] Length = 289 Score = 28.5 bits (62), Expect = 4.9 Identities = 13/40 (32%), Positives = 23/40 (57%) Query: 18 MLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDV 57 +++ +P A +A+T + Q ELLK W + C L+ D+ Sbjct: 185 LILDEPFGALDAITKEELQEELLKIWGDNRCTVLMITHDI 224
>gb|ZP_00105962.1| (NZ_AABC01000058) hypothetical protein [Nostoc punctiforme] Length = 245 Score = 28.5 bits (62), Expect = 4.9 Identities = 13/40 (32%), Positives = 23/40 (57%) Query: 18 MLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDV 57 +++ +P A +A+T + Q ELLK W + C L+ D+ Sbjct: 141 LILDEPFGALDAITKEELQEELLKIWGDNRCTVLMITHDI 180
>gb|ZP_00079868.1| (NZ_AAAS01000002) hypothetical protein [Geobacter metallireducens] Length = 752 Score = 28.5 bits (62), Expect = 5.5 Identities = 19/57 (33%), Positives = 28/57 (48%), Gaps = 1/57 (1%) Query: 38 ELLKNWALSHCL-ALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIAKKYSGL 93 E + W LS A YKD+V+KND A Y G +V++ ++ + SGL Sbjct: 202 ETKEKWFLSWLTGAGTYKDEVLKNDVNLIADLYFNNGYVNVKVGEPDVKVLEDRSGL 258
>gb|ZP_00092565.1| (NZ_AAAD01000091) hypothetical protein [Azotobacter vinelandii] Length = 416 Score = 28.5 bits (62), Expect = 5.7 Identities = 15/23 (65%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Query: 79 IYHEIDEIAKKYS-GLKYNGSIS 100 +YHEI +AKK S GLKY SIS Sbjct: 212 MYHEIPSVAKKASWGLKYTRSIS 234
>gb|ZP_00085892.1| (NZ_AABA01000138) hypothetical protein [Pseudomonas fluorescens] Length = 416 Score = 28.5 bits (62), Expect = 5.7 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 2/29 (6%) Query: 79 IYHEIDEIAKKYS-GLKYNGSISS-DFNT 105 +YHEI +AKK + GLKY +IS +FNT Sbjct: 212 MYHEIPSVAKKAAWGLKYTRAISDPEFNT 240
>pir||S46920 transcription repressor - Mycoplasma capricolum (SGC3) (fragment) pir||S77828 probable transcription repressor MC063 - Mycoplasma capricolum (fragment) emb|CAA83725.1| (Z33052) transcription repressor [Mycoplasma capricolum] Length = 224 Score = 28.5 bits (62), Expect = 5.7 Identities = 25/77 (32%), Positives = 37/77 (47%), Gaps = 9/77 (11%) Query: 52 VYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKC--- 108 VY D+ ND + A+LEY K+ E Y E++E+ + Y+ T C Sbjct: 11 VYYTDI--NDKKVIELAFLEYKKKYDEFYVELEELKNYMTAEDYHQDYLDKNPTGYCHVN 68 Query: 109 --IDF-IHDRELNELIK 122 +DF + D+E ELIK Sbjct: 69 LNVDFNLTDKE-QELIK 84
>ref|NP_249846.1| (NC_002516) ribonucleoside reductase, small chain [Pseudomonas aeruginosa] pir||A83502 ribonucleoside reductase, small chain PA1155 [imported] - Pseudomonas aeruginosa (strain PAO1) gb|AAG04544.1|AE004545_7 (AE004545) ribonucleoside reductase, small chain [Pseudomonas aeruginosa] Length = 415 Score = 28.1 bits (61), Expect = 6.7 Identities = 15/23 (65%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Query: 79 IYHEIDEIAKKYS-GLKYNGSIS 100 +YHEI +AKK S GLKY SIS Sbjct: 211 MYHEIPSVAKKASWGLKYTRSIS 233
>ref|NP_224077.1| (NC_000921) putative [Helicobacter pylori J99] pir||A71818 hypothetical protein jhp1359 - Helicobacter pylori (strain J99) gb|AAD06935.1| (AE001558) putative [Helicobacter pylori J99] Length = 377 Score = 28.1 bits (61), Expect = 7.1 Identities = 15/42 (35%), Positives = 24/42 (56%), Gaps = 2/42 (4%) Query: 83 IDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRR 124 +DE+ K L + GS+ DF+ + IDF+ L +L+K R Sbjct: 35 LDELKKNL--LDHQGSLKMDFSGCQKIDFVFGMFLFDLVKER 74
>gb|ZP_00065184.1| (NZ_AAAT01000002) hypothetical protein [Microbulbifer degradans 2-40] Length = 168 Score = 28.1 bits (61), Expect = 7.1 Identities = 13/49 (26%), Positives = 25/49 (50%), Gaps = 8/49 (16%) Query: 7 WLILVTFSISGMLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKD 55 W IL +S ++ + F +EAL+ + NW ++ +A+ +KD Sbjct: 6 WAILAILLVSSLISLKRGFVKEALS--------MLNWVIAFFIAMSFKD 46
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Sep 22, 2002 1:02 PM Number of letters in database: 371,327,854 Number of sequences in database: 1,172,300 Lambda K H 0.318 0.132 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,815,718 Number of Sequences: 1172300 Number of extensions: 952650 Number of successful extensions: 2875 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 26 Number of HSP's that attempted gapping in prelim test: 2863 Number of HSP's gapped (non-prelim): 38 length of query: 127 length of database: 126,083,458 effective HSP length: 103 effective length of query: 24 effective length of database: 83,891,671 effective search space: 2013400104 effective search space used: 2013400104 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 60 (27.7 bits)