Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.RID: 1013184638-25241-5445
Query= 3H5_131_132_TBLASTX (465 letters)
Database: All GenBank+EMBL+DDBJ+PDB sequences (but no EST, STS, GSS, or phase 0, 1 or 2 HTGS sequences) 1,170,126 sequences; 4,850,248,762 total letters
If you have any problems or questions with the results of this search
please refer to the BLAST FAQsScore E Sequences producing significant alignments: (bits) Value N gi|11379536|gb|AE000037.2|AE000037 Mycoplasma pneumonia... 35 0.98 1 gi|639784|gb|L38997.1|MYCHMWB Mycoplasman pneumoniae cy... 35 0.98 1 gi|16876432|gb|AF098273.2|AF098273 Bacillus stearotherm... 32 2.9 2 gi|14349227|dbj|AP003135.2| Staphylococcus aureus subsp... 32 4.8 1 gi|14247399|dbj|AP003363.2| Staphylococcus aureus subsp... 32 4.8 1 gi|2313337|gb|AE000544.1|AE000544 Helicobacter pylori 2... 29 9.5 2Alignments >gi|11379536|gb|AE000037.2|AE000037 Mycoplasma pneumoniae M129 section 43 of 63 of the complete genome Length = 11341 Score = 34.5 bits (69), Expect = 0.98 Identities = 13/41 (31%), Positives = 23/41 (55%) Frame = +2 / +3 Query: 8 LR*KCEISNVFNNHANFVVTFESRRKHAKRNQNAPKECDAP 130 +R K E++ + +F + + KHAK+ + PK C+AP Sbjct: 2595 MRIKVEVNTACSGFHSFTLLMANNTKHAKKEKLKPKLCNAP 2717>gi|639784|gb|L38997.1|MYCHMWB Mycoplasman pneumoniae cytadherence-accessory protein HMW1 (hmw1) gene, complete cds; cytadherence-accessory protein HMW3 (hmw3) gene, complete cds; ribosomal protein S4 (RPS4) gene, complete cds; multiple ORFS, complete cds's Length = 10477 Score = 34.5 bits (69), Expect = 0.98 Identities = 13/41 (31%), Positives = 23/41 (55%) Frame = +2 / -1 Query: 8 LR*KCEISNVFNNHANFVVTFESRRKHAKRNQNAPKECDAP 130 +R K E++ + +F + + KHAK+ + PK C+AP Sbjct: 3013 MRIKVEVNTACSGFHSFTLLMANNTKHAKKEKLKPKLCNAP 2891>gi|16876432|gb|AF098273.2|AF098273 Bacillus stearothermophilus beta-xylosidase (xynB2) gene, partial cds; intra-cellular xylanase (xynA2) gene, complete cds; glucuronic acid catabolism operon, complete sequence; extra-cellular xylanase (xynA) gene, complete cds; and unknown genes Length = 23464 Score = 31.8 bits (63), Expect(2) = 2.9 Identities = 9/17 (52%), Positives = 15/17 (87%) Frame = +1 / +2 Query: 79 QKARKTKPKCTKRVRCT 129 Q+++K+KP+C+ R RCT Sbjct: 3524 QRSKKSKPRCSPRARCT 3574Score = 24.4 bits (47), Expect(2) = 2.9 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 / +2 Query: 135 GYKLCDKIFLYSIGYML 185 G++LCD ++ IGY L Sbjct: 6785 GFQLCDSCWIV*IGYQL 6835>gi|14349227|dbj|AP003135.2| Staphylococcus aureus subsp. aureus N315 genomic DNA, complete genome, section 7/10 Length = 291150 Score = 32.2 bits (64), Expect = 4.8 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 / +2 Query: 400 VSSFIFLEL*LEPCPSRPIYSLGCDFI 320 V+ FI+ L + PCP R IY + D++ Sbjct: 27326 VAGFIYCRLGISPCPERIIYEIVIDYL 27406>gi|14247399|dbj|AP003363.2| Staphylococcus aureus subsp. aureus Mu50 genomic DNA, complete sequence, section 6/9 Length = 342600 Score = 32.2 bits (64), Expect = 4.8 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 / +2 Query: 400 VSSFIFLEL*LEPCPSRPIYSLGCDFI 320 V+ FI+ L + PCP R IY + D++ Sbjct: 170387 VAGFIYCRLGISPCPERIIYEIVIDYL 170467>gi|2313337|gb|AE000544.1|AE000544 Helicobacter pylori 26695 section 22 of 134 of the complete genome Length = 11908 Score = 29.0 bits (57), Expect(2) = 9.5 Identities = 12/32 (37%), Positives = 16/32 (49%) Frame = -3 / -3 Query: 151 SHNL*PKWCIALFWCILVSFCVLSARFKSNDK 56 S L*P C LFWC L C + + ++K Sbjct: 7676 SLRL*PLACCFLFWCSLAKGCAMLSTLTCSNK 7581Score = 24.4 bits (47), Expect(2) = 9.5 Identities = 8/18 (44%), Positives = 11/18 (60%) Frame = -3 / -3 Query: 352 RPIYSLGCDFIFWYFMSP 299 RP++ L C +IFW P Sbjct: 7799 RPVFLL*CLWIFWVLACP 7746Database: All GenBank+EMBL+DDBJ+PDB sequences (but no EST, STS, GSS, or phase 0, 1 or 2 HTGS sequences) Posted date: Feb 7, 2002 11:33 PM Number of letters in database: 555,281,466 Number of sequences in database: 0 Lambda K H 0.318 0.135 0.401 Matrix: BLOSUM62 Number of Hits to DB: 314,679,267 Number of Sequences: 0 Number of extensions: 3772018 Number of successful extensions: 242342 Number of sequences better than 10.0: 6 length of database: 121,197,164 effective HSP length: 50 effective length of database: 115,015,814 effective search space used: 11961644656 frameshift window, decay const: 50, 0.5 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 0 ( 0.0 bits) S1: 41 (21.7 bits)