Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.RID: 1014963996-11046-15326
Query= 8E2_131_132BLASTX (1161 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 887,402 sequences; 277,845,443 total letters
If you have any problems or questions with the results of this search
please refer to the BLAST FAQsScore E Sequences producing significant alignments: (bits) Value gi|16123048|ref|NP_406361.1| (NC_003143) putative protease ... 158 3e-38 gi|15640736|ref|NP_230366.1| (NC_002505) protease, putative... 138 3e-32 gi|15802562|ref|NP_288589.1| (NC_002655) orf, hypothetical ... 132 1e-30 gi|16130021|ref|NP_416585.1| (NC_000913) orf, hypothetical ... 132 2e-30 gi|16761079|ref|NP_456696.1| (NC_003198) putative protease ... 129 1e-29 gi|16272368|ref|NP_438581.1| (NC_000907) protease, putative... 129 1e-29 gi|15600633|ref|NP_254127.1| (NC_002516) probable peptidase... 129 2e-29 gi|15602098|ref|NP_245170.1| (NC_002663) unknown [Pasteurel... 126 1e-28 gi|12802667|gb|AAK08043.1|AF319533_4 (AF319533) Col [Neisse... 84 6e-16 gi|12802662|gb|AAK08039.1|AF319532_5 (AF319532) Col [Neisse... 84 6e-16 gi|12802679|gb|AAK08053.1|AF319535_8 (AF319535) Col [Neisse... 84 6e-16 gi|15794808|ref|NP_284630.1| (NC_003116) probable protease ... 82 4e-15 gi|15677513|ref|NP_274669.1| (NC_003112) protease, putative... 79 2e-14 gi|16123049|ref|NP_406362.1| (NC_003143) putative diacylgly... 43 5e-06 gi|16130026|ref|NP_416590.1| (NC_000913) orf, hypothetical ... 40 2e-04 gi|15802564|ref|NP_288591.1| (NC_002655) orf, hypothetical ... 39 5e-04 gi|16765469|ref|NP_461084.1| (NC_003197) putative diacylgly... 34 0.001 gi|15598219|ref|NP_251713.1| (NC_002516) conserved hypothet... 33 0.005 gi|15896227|ref|NP_349576.1| (NC_003030) Predicted protease... 39 0.036 gi|15894964|ref|NP_348313.1| (NC_003030) Collagenase family... 37 0.10 gi|12802653|gb|AAK08031.1|AF319531_1 (AF319531) Col [Neisse... 33 1.2 gi|18310753|ref|NP_562687.1| (NC_003366) probable protease ... 33 1.5 gi|4139776|pdb|1B23|P Chain P, E. Coli Cysteinyl-Trna And T... 33 2.0 gi|399423|sp|Q01698|EFTU_THEAQ Elongation factor Tu (EF-Tu)... 33 2.0 gi|15642087|ref|NP_231719.1| (NC_002505) 2-oxoglutarate deh... 32 3.4 gi|640371|pdb|1EFT| Elongation Factor Tu (Ef-Tu) Complexed... 32 4.4 gi|8569263|pdb|1EXM|A Chain A, Crystal Structure Of Thermus... 32 4.4 gi|2624675|pdb|1AIP|E Chain E, Ef-Tu Ef-Ts Complex From The... 32 4.4 gi|119215|sp|P07157|EFTU_THETH Elongation factor Tu (EF-Tu)... 32 4.4 gi|94735|pir||S17146 translation elongation factor EF-Tu.B ... 32 4.4 gi|48288|emb|CAA29397.1| (X05977) elongation factor Tu (AA ... 32 4.4 gi|15639017|ref|NP_218463.1| (NC_000919) sodium- and chlori... 31 5.7 gi|17935561|ref|NP_532351.1| (NC_003304) conserved hypothet... 31 7.5 gi|12802635|gb|AAK08017.1|AF319527_1 (AF319527) Col [Neisse... 30 9.8Alignments >gi|16123048|ref|NP_406361.1| (NC_003143) putative protease [Yersinia pestis] gi|15980823|emb|CAC92106.1| (AJ414154) putative protease [Yersinia pestis] Length = 464 Score = 158 bits (399), Expect = 3e-38 Identities = 79/111 (71%), Positives = 92/111 (82%), Gaps = 1/111 (0%) Frame = +3 Query: 72 GFLGRHVTKAAEX-EYGSSLSERXQFVGEFTGVRREGWAEVDVKNKFSLGDSVEMMTPGG 248 GFL RHV + + EYG S+SER QFVGEFTGVRREG AEV VKNKFS GDSVE+MTP G Sbjct: 347 GFLRRHVHEEQQTYEYGYSVSERQQFVGEFTGVRREGLAEVLVKNKFSRGDSVELMTPKG 406 Query: 249 NVLFTLESMQNKKGEPIEVAPGNGHIVYLPIPQDIDLNYALLIRNLAEENS 401 N+ FTLESMQ+KKG+P ++APGNGHI+YLPIP++ID+ Y LLIRNL NS Sbjct: 407 NIQFTLESMQDKKGQPADIAPGNGHIMYLPIPEEIDVEYGLLIRNLNGTNS 457>gi|15640736|ref|NP_230366.1| (NC_002505) protease, putative [Vibrio cholerae] gi|11279686|pir||F82288 probable proteinase (EC 3.4.-.-) VC0717 [imported] - Vibrio cholerae (group O1 strain N16961) gi|9655160|gb|AAF93882.1| (AE004158) protease, putative [Vibrio cholerae] Length = 466 Score = 138 bits (347), Expect = 3e-32 Identities = 66/108 (61%), Positives = 86/108 (79%), Gaps = 1/108 (0%) Frame = +3 Query: 72 GFLGRHVTKAAEX-EYGSSLSERXQFVGEFTGVRREGWAEVDVKNKFSLGDSVEMMTPGG 248 GFL RH A + +YG S+S+ QFVGEFTG RR AEV+VKNKF LGDS+E+MTP G Sbjct: 349 GFLRRHTHDAYQNYDYGYSVSDTQQFVGEFTGKRRGAMAEVEVKNKFVLGDSLELMTPKG 408 Query: 249 NVLFTLESMQNKKGEPIEVAPGNGHIVYLPIPQDIDLNYALLIRNLAE 392 NV+FTLE+M+N+KGE + A GNGH VY+P+P+++DL+YALL+RNL + Sbjct: 409 NVIFTLEAMENRKGEATDDAKGNGHFVYIPVPEELDLSYALLMRNLVQ 456>gi|15802562|ref|NP_288589.1| (NC_002655) orf, hypothetical protein [Escherichia coli O157:H7 EDL933] gi|15832143|ref|NP_310916.1| (NC_002695) hypothetical protein [Escherichia coli O157:H7] gi|12516290|gb|AAG57144.1|AE005435_2 (AE005435) orf, hypothetical protein [Escherichia coli O157:H7 EDL933] gi|13362358|dbj|BAB36312.1| (AP002560) hypothetical protein [Escherichia coli O157:H7] Length = 453 Score = 132 bits (333), Expect = 1e-30 Identities = 66/111 (59%), Positives = 85/111 (76%), Gaps = 1/111 (0%) Frame = +3 Query: 72 GFLGRHVTKAAEX-EYGSSLSERXQFVGEFTGVRREGWAEVDVKNKFSLGDSVEMMTPGG 248 GFL RH + EYG S+S+R QFVGEFTG R+ A V VKNKFS+GDS+E+MTP G Sbjct: 337 GFLRRHTHDDYQNYEYGYSVSDRQQFVGEFTGERKGDLAAVAVKNKFSVGDSLELMTPQG 396 Query: 249 NVLFTLESMQNKKGEPIEVAPGNGHIVYLPIPQDIDLNYALLIRNLAEENS 401 N+ FTLE M+N KGE + VAPG+G+ V+LP+PQD++LNYALL+RN + E + Sbjct: 397 NINFTLEHMENAKGEAMPVAPGDGYTVWLPVPQDLELNYALLMRNFSGETT 447>gi|16130021|ref|NP_416585.1| (NC_000913) orf, hypothetical protein [Escherichia coli K12] gi|2499891|sp|P76403|YEGQ_ECOLI PUTATIVE PROTEASE YEGQ gi|7449026|pir||H64974 hypothetical protein b2081 - Escherichia coli (strain K-12) gi|1736789|dbj|BAA15936.1| (D90846) Collagenase precursor (EC 3.4.-.-). [Escherichia coli] gi|1736801|dbj|BAA15947.1| (D90847) Collagenase precursor (EC 3.4.-.-). [Escherichia coli] gi|1788397|gb|AAC75142.1| (AE000298) orf, hypothetical protein [Escherichia coli K12] Length = 453 Score = 132 bits (332), Expect = 2e-30 Identities = 65/111 (58%), Positives = 85/111 (76%), Gaps = 1/111 (0%) Frame = +3 Query: 72 GFLGRHVTKAAEX-EYGSSLSERXQFVGEFTGVRREGWAEVDVKNKFSLGDSVEMMTPGG 248 GFL RH + EYG S+S+R QFVGEFTG R+ A V VKNKFS+GDS+E+MTP G Sbjct: 337 GFLRRHTHDDYQNYEYGYSVSDRQQFVGEFTGERKGDLAAVAVKNKFSVGDSLELMTPQG 396 Query: 249 NVLFTLESMQNKKGEPIEVAPGNGHIVYLPIPQDIDLNYALLIRNLAEENS 401 N+ FTLE M+N KGE + +APG+G+ V+LP+PQD++LNYALL+RN + E + Sbjct: 397 NINFTLEHMENAKGEAMPIAPGDGYTVWLPVPQDLELNYALLMRNFSGETT 447>gi|16761079|ref|NP_456696.1| (NC_003198) putative protease [Salmonella enterica subsp. enterica serovar Typhi] gi|16765465|ref|NP_461080.1| (NC_003197) putative protease [Salmonella typhimurium LT2] gi|16420670|gb|AAL21039.1| (AE008795) putative protease [Salmonella typhimurium LT2] gi|16503377|emb|CAD02515.1| (AL627273) putative protease [Salmonella enterica subsp. enterica serovar Typhi] Length = 453 Score = 129 bits (325), Expect = 1e-29 Identities = 64/111 (57%), Positives = 85/111 (75%), Gaps = 1/111 (0%) Frame = +3 Query: 72 GFLGRHVTKAAEX-EYGSSLSERXQFVGEFTGVRREGWAEVDVKNKFSLGDSVEMMTPGG 248 GFL RH + EYG S+SER QFVGEFTG R+ A V VKNKFS+GDS+E+MTP G Sbjct: 337 GFLRRHTHDDYQNYEYGYSVSERQQFVGEFTGERKGQLAAVAVKNKFSVGDSLELMTPQG 396 Query: 249 NVLFTLESMQNKKGEPIEVAPGNGHIVYLPIPQDIDLNYALLIRNLAEENS 401 N+ FTLE M+N KG+ + VAPG+G+ V++P+PQD+ L+YALL+RN + E++ Sbjct: 397 NINFTLEQMENAKGDAMPVAPGDGYTVWMPVPQDVTLDYALLMRNFSGEST 447>gi|16272368|ref|NP_438581.1| (NC_000907) protease, putative [Haemophilus influenzae Rd] gi|1176181|sp|P44700|YEGQ_HAEIN Putative protease HI0419 gi|1073949|pir||G64066 collagenase prtC homolog - Haemophilus influenzae (strain Rd KW20) gi|1573393|gb|AAC22077.1| (U32725) protease, putative [Haemophilus influenzae Rd] Length = 460 Score = 129 bits (325), Expect = 1e-29 Identities = 67/112 (59%), Positives = 82/112 (72%), Gaps = 2/112 (1%) Frame = +3 Query: 72 GFLGRHV-TKAAEXEYGSSLSERXQFVGEFTGVRRE-GWAEVDVKNKFSLGDSVEMMTPG 245 GFL RH + EYG S+S+R QFVGEFTG R E G AEV VKNKF LGD+VEMMTP Sbjct: 343 GFLRRHTHDEYQNYEYGYSISDRQQFVGEFTGKRNEQGMAEVAVKNKFLLGDNVEMMTPQ 402 Query: 246 GNVLFTLESMQNKKGEPIEVAPGNGHIVYLPIPQDIDLNYALLIRNLAEENS 401 GN+ F +E M N+K E ++ A G+GH V+L +PQDI+LNYALL+RNL N+ Sbjct: 403 GNINFKIEKMLNRKNETVDAALGDGHFVFLNVPQDINLNYALLMRNLVNTNT 454>gi|15600633|ref|NP_254127.1| (NC_002516) probable peptidase [Pseudomonas aeruginosa] gi|11351629|pir||C82967 probable peptidase PA5440 [imported] - Pseudomonas aeruginosa (strain PAO1) gi|9951769|gb|AAG08825.1|AE004956_9 (AE004956) probable peptidase [Pseudomonas aeruginosa] Length = 464 Score = 129 bits (323), Expect = 2e-29 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 1/106 (0%) Frame = +3 Query: 72 GFLGRHV-TKAAEXEYGSSLSERXQFVGEFTGVRREGWAEVDVKNKFSLGDSVEMMTPGG 248 GFL RHV + ++G SLSER QFVGE TG RR+G AEV+VKN+F GDSVE+MTP G Sbjct: 332 GFLRRHVHDEYQNYQHGHSLSERQQFVGELTGERRDGLAEVEVKNRFQRGDSVELMTPRG 391 Query: 249 NVLFTLESMQNKKGEPIEVAPGNGHIVYLPIPQDIDLNYALLIRNL 386 N+ +E ++N GE IEVAPGNGH+VYL +P+ +DL YALL+R+L Sbjct: 392 NLSLRVEDLRNAAGEAIEVAPGNGHVVYLALPEGLDLCYALLMRDL 437>gi|15602098|ref|NP_245170.1| (NC_002663) unknown [Pasteurella multocida] gi|12720459|gb|AAK02317.1| (AE006057) unknown [Pasteurella multocida] Length = 456 Score = 126 bits (316), Expect = 1e-28 Identities = 64/112 (57%), Positives = 80/112 (71%), Gaps = 2/112 (1%) Frame = +3 Query: 72 GFLGRHV-TKAAEXEYGSSLSERXQFVGEFTGVRRE-GWAEVDVKNKFSLGDSVEMMTPG 245 GFL RH + +YG S+SER QFVGEFTG R E G AEV VKNKF LGD VEMMTP Sbjct: 339 GFLRRHTHDEYQNYDYGYSISERQQFVGEFTGKRNEQGMAEVAVKNKFLLGDEVEMMTPK 398 Query: 246 GNVLFTLESMQNKKGEPIEVAPGNGHIVYLPIPQDIDLNYALLIRNLAEENS 401 GN++F +E M N+K E +E G+GH V+L +P+D+ L+YALL+RNL N+ Sbjct: 399 GNIVFKIERMLNRKNENVEAGLGDGHFVFLDVPEDVQLDYALLMRNLVNTNT 450>gi|12802667|gb|AAK08043.1|AF319533_4 (AF319533) Col [Neisseria meningitidis] Length = 328 Score = 84.3 bits (207), Expect = 6e-16 Identities = 42/90 (46%), Positives = 62/90 (68%), Gaps = 1/90 (1%) Frame = +3 Query: 72 GFLGRHVTKAAEXEY-GSSLSERXQFVGEFTGVRREGWAEVDVKNKFSLGDSVEMMTPGG 248 GFL RH T+ + G S++++ Q+VG T + EGWA V+VKN+F++GDS+E++ P G Sbjct: 224 GFLERHQTQDYQNYLTGHSIAKQSQYVGHVTEIDAEGWATVEVKNRFAIGDSLEIIHPSG 283 Query: 249 NVLFTLESMQNKKGEPIEVAPGNGHIVYLP 338 N LE M +KG+P++VAPGNG V +P Sbjct: 284 NQTIKLEQMA-RKGQPVDVAPGNGIQVKIP 312>gi|12802662|gb|AAK08039.1|AF319532_5 (AF319532) Col [Neisseria meningitidis] Length = 341 Score = 84.3 bits (207), Expect = 6e-16 Identities = 42/90 (46%), Positives = 62/90 (68%), Gaps = 1/90 (1%) Frame = +3 Query: 72 GFLGRHVTKAAEXEY-GSSLSERXQFVGEFTGVRREGWAEVDVKNKFSLGDSVEMMTPGG 248 GFL RH T+ + G S++++ Q+VG T + EGWA V+VKN+F++GDS+E++ P G Sbjct: 237 GFLERHQTQDYQNYLTGHSIAKQSQYVGHVTEIDAEGWATVEVKNRFAIGDSLEIIHPSG 296 Query: 249 NVLFTLESMQNKKGEPIEVAPGNGHIVYLP 338 N LE M +KG+P++VAPGNG V +P Sbjct: 297 NQTIKLEQMA-RKGQPVDVAPGNGIQVKIP 325>gi|12802679|gb|AAK08053.1|AF319535_8 (AF319535) Col [Neisseria meningitidis] Length = 333 Score = 84.3 bits (207), Expect = 6e-16 Identities = 41/90 (45%), Positives = 62/90 (68%), Gaps = 1/90 (1%) Frame = +3 Query: 72 GFLGRHVTKAAEXEY-GSSLSERXQFVGEFTGVRREGWAEVDVKNKFSLGDSVEMMTPGG 248 GFL RH T+ + G S++++ Q+VG T + GWA ++VKN+F++GDS+E++ PGG Sbjct: 229 GFLERHQTQDYQNYLTGHSIAKQSQYVGHVTEIDENGWATIEVKNRFAVGDSLEIIHPGG 288 Query: 249 NVLFTLESMQNKKGEPIEVAPGNGHIVYLP 338 N LE M +KG+P++VAPGNG V +P Sbjct: 289 NQTIKLEQMA-RKGQPVDVAPGNGIQVKIP 317>gi|15794808|ref|NP_284630.1| (NC_003116) probable protease [Neisseria meningitidis Z2491] gi|11279687|pir||C81820 probable proteinase NMA1923 [imported] - Neisseria meningitidis (group A strain Z2491) gi|7380557|emb|CAB85144.1| (AL162757) probable protease [Neisseria meningitidis Z2491] Length = 451 Score = 81.6 bits (200), Expect = 4e-15 Identities = 40/90 (44%), Positives = 61/90 (67%), Gaps = 1/90 (1%) Frame = +3 Query: 72 GFLGRHVTKAAEXEY-GSSLSERXQFVGEFTGVRREGWAEVDVKNKFSLGDSVEMMTPGG 248 GFL RH T+ + G S +++ Q+VG T + + GWA ++VKN+F++GDS+E++ P G Sbjct: 347 GFLERHQTQDYQNYLSGHSTAKQSQYVGHVTEIDKNGWATIEVKNRFAVGDSLEIIHPNG 406 Query: 249 NVLFTLESMQNKKGEPIEVAPGNGHIVYLP 338 N LE M +KG+P++VAPGNG V +P Sbjct: 407 NQTIKLEQMA-RKGQPVDVAPGNGIQVKIP 435>gi|15677513|ref|NP_274669.1| (NC_003112) protease, putative [Neisseria meningitidis MC58] gi|11279689|pir||B81056 proteinase, probable NMB1664 [imported] - Neisseria meningitidis (group B strain MD58) gi|7226917|gb|AAF42013.1| (AE002517) protease, putative [Neisseria meningitidis MC58] Length = 451 Score = 79.3 bits (194), Expect = 2e-14 Identities = 40/90 (44%), Positives = 59/90 (65%), Gaps = 1/90 (1%) Frame = +3 Query: 72 GFLGRHVTKAAEXEY-GSSLSERXQFVGEFTGVRREGWAEVDVKNKFSLGDSVEMMTPGG 248 GFL RH T+ + G S +++ Q+VG T + GWA V+VKN+F++ DS+E++ P G Sbjct: 347 GFLERHQTQDYQNYLTGHSTAKQSQYVGHVTEIDENGWATVEVKNRFAVSDSLEIIHPSG 406 Query: 249 NVLFTLESMQNKKGEPIEVAPGNGHIVYLP 338 N LE M +KG+P++VAPGNG V +P Sbjct: 407 NQTIKLEQM-TRKGQPVDVAPGNGIQVKIP 435>gi|16123049|ref|NP_406362.1| (NC_003143) putative diacylglycerol kinase [Yersinia pestis] gi|15980824|emb|CAC92107.1| (AJ414154) putative diacylglycerol kinase [Yersinia pestis] Length = 296 Score = 43.1 bits (100), Expect(2) = 5e-06 Identities = 20/34 (58%), Positives = 22/34 (63%) Frame = +3 Query: 1002 TLYVRVTWEHGDAARYVAEADTWRRXPSSRGGAD 1103 TL+VR+TWEHGDA RYV EA T GG D Sbjct: 31 TLHVRITWEHGDAKRYVEEAATLAVSTVIAGGGD 64Score = 27.7 bits (60), Expect(2) = 5e-06 Identities = 12/17 (70%), Positives = 15/17 (87%) Frame = +2 Query: 926 LLILNGKGAGNEELRQA 976 LLILNGK +GN E+R+A Sbjct: 5 LLILNGKESGNPEVREA 21>gi|16130026|ref|NP_416590.1| (NC_000913) orf, hypothetical protein [Escherichia coli K12] gi|2495625|sp|P76407|YEGS_ECOLI HYPOTHETICAL 32.0 KDA PROTEIN IN OGRK-GATR INTERGENIC REGION gi|7466288|pir||E64975 hypothetical protein b2086 - Escherichia coli (strain K-12) gi|1736792|dbj|BAA15939.1| (D90846) BmrU protein. [Escherichia coli] gi|1736804|dbj|BAA15950.1| (D90847) BmrU protein. [Escherichia coli] gi|1788402|gb|AAC75147.1| (AE000298) orf, hypothetical protein [Escherichia coli K12] Length = 299 Score = 39.7 bits (91), Expect(2) = 2e-04 Identities = 19/34 (55%), Positives = 22/34 (63%) Frame = +3 Query: 1002 TLYVRVTWEHGDAARYVAEADTWRRXPSSRGGAD 1103 T++VRVTWE GDAARYV EA + GG D Sbjct: 34 TIHVRVTWEKGDAARYVEEARKFGVATVIAGGGD 67Score = 25.4 bits (54), Expect(2) = 2e-04 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +2 Query: 920 AALLILNGKGAGNEELRQA 976 A+LLILNGK N LR+A Sbjct: 6 ASLLILNGKSTDNLPLREA 24>gi|15802564|ref|NP_288591.1| (NC_002655) orf, hypothetical protein [Escherichia coli O157:H7 EDL933] gi|15832146|ref|NP_310919.1| (NC_002695) hypothetical protein [Escherichia coli O157:H7] gi|12516292|gb|AAG57146.1|AE005435_4 (AE005435) orf, hypothetical protein [Escherichia coli O157:H7 EDL933] gi|13362361|dbj|BAB36315.1| (AP002560) hypothetical protein [Escherichia coli O157:H7] Length = 299 Score = 38.5 bits (88), Expect(2) = 5e-04 Identities = 19/34 (55%), Positives = 21/34 (60%) Frame = +3 Query: 1002 TLYVRVTWEHGDAARYVAEADTWRRXPSSRGGAD 1103 T++VRVTWE GDAARYV EA GG D Sbjct: 34 TIHVRVTWEKGDAARYVEEARKLGVATVIAGGGD 67Score = 25.4 bits (54), Expect(2) = 5e-04 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +2 Query: 920 AALLILNGKGAGNEELRQA 976 A+LLILNGK N LR+A Sbjct: 6 ASLLILNGKSTDNLPLREA 24>gi|16765469|ref|NP_461084.1| (NC_003197) putative diacylglycerol kinase catalytic domain [Salmonella typhimurium LT2] gi|16420674|gb|AAL21043.1| (AE008795) putative diacylglycerol kinase catalytic domain [Salmonella typhimurium LT2] Length = 299 Score = 33.9 bits (76), Expect(2) = 0.001 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +3 Query: 1005 LYVRVTWEHGDAARYVAEADTWRRXPSSRGGAD 1103 ++VRVTWE GDA RYV EA GG D Sbjct: 35 IHVRVTWEKGDAQRYVDEARRLGVETVIAGGGD 67Score = 28.9 bits (63), Expect(2) = 0.001 Identities = 13/19 (68%), Positives = 16/19 (83%) Frame = +2 Query: 920 AALLILNGKGAGNEELRQA 976 A+LLILNGK A N+ LR+A Sbjct: 6 ASLLILNGKSADNQPLREA 24>gi|15598219|ref|NP_251713.1| (NC_002516) conserved hypothetical protein [Pseudomonas aeruginosa] gi|11347969|pir||D83268 conserved hypothetical protein PA3023 [imported] - Pseudomonas aeruginosa (strain PAO1) gi|9949126|gb|AAG06411.1|AE004727_7 (AE004727) conserved hypothetical protein [Pseudomonas aeruginosa] Length = 302 Score = 32.7 bits (73), Expect(2) = 0.005 Identities = 22/47 (46%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +3 Query: 969 VRRHTAARR--ANTLYVRVTWEHGDAARYVAEADTWRRXPSSRGGAD 1103 VR AA+R L VRVTWE GDA R V EA GG D Sbjct: 20 VRAAVAAQREAGRELAVRVTWEDGDARRIVEEALAAGYATLVAGGGD 66Score = 27.7 bits (60), Expect(2) = 0.005 Identities = 12/17 (70%), Positives = 15/17 (87%) Frame = +2 Query: 926 LLILNGKGAGNEELRQA 976 LL+L+GK AGNEE+R A Sbjct: 7 LLVLHGKQAGNEEVRAA 23>gi|15896227|ref|NP_349576.1| (NC_003030) Predicted protease from collagenase family [Clostridium acetobutylicum] gi|15026029|gb|AAK80916.1|AE007794_8 (AE007794) Predicted protease from collagenase family [Clostridium acetobutylicum] Length = 406 Score = 38.5 bits (88), Expect = 0.036 Identities = 17/44 (38%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = +3 Query: 183 AEVDVKNKFSLGDSVEMMTP-GGNVLFTLESMQNKKGEPIEVAP 311 A ++ KNK G+ VE+++P G N++ +++ M+NK+G+ I+ AP Sbjct: 337 ATIEQKNKVYNGNKVEILSPKGDNIVMSIKDMRNKQGKVIDSAP 380>gi|15894964|ref|NP_348313.1| (NC_003030) Collagenase family protease [Clostridium acetobutylicum] gi|15024650|gb|AAK79653.1|AE007678_9 (AE007678) Collagenase family protease [Clostridium acetobutylicum] Length = 406 Score = 37.0 bits (84), Expect = 0.10 Identities = 19/49 (38%), Positives = 29/49 (58%), Gaps = 1/49 (2%) Frame = +3 Query: 168 RREGWAEVDVKNKFSLGDSVEMMTP-GGNVLFTLESMQNKKGEPIEVAP 311 + G A ++ +NK GD VE++ P G N+ L+ ++NK GE IE P Sbjct: 333 KETGIAVIEQRNKCYAGDKVEVLRPRGENLEIELKDLKNKDGEAIESTP 381>gi|12802653|gb|AAK08031.1|AF319531_1 (AF319531) Col [Neisseria meningitidis] Length = 47 Score = 33.5 bits (75), Expect = 1.2 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = +3 Query: 246 GNVLFTLESMQNKKGEPIEVAPGNGHIVYLP 338 GN LE M +KG+P++VAPGNG V +P Sbjct: 2 GNQTIKLEQM-TRKGQPVDVAPGNGIQVKIP 31>gi|18310753|ref|NP_562687.1| (NC_003366) probable protease [Clostridium perfringens] gi|18145434|dbj|BAB81477.1| (AP003191) probable protease [Clostridium perfringens] Length = 409 Score = 33.1 bits (74), Expect = 1.5 Identities = 19/65 (29%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Frame = +3 Query: 183 AEVDVKNKFSLGDSVEMMTPGGNVL-FTLESMQNKKGEPIEVAPGNGHIVYLPIPQDIDL 359 A ++ +N+ GD+VE++TP G+ + M+++K E I+VA I + I + + + Sbjct: 338 ATIEQRNRLFEGDTVEVLTPVGDYYEIQMNDMKDEKDEKIDVANKAQMIFKVKIDKPVKV 397 Query: 360 NYALL 374 N L+ Sbjct: 398 NDMLI 402>gi|4139776|pdb|1B23|P Chain P, E. Coli Cysteinyl-Trna And T. Aquaticus Elongation Factor Ef-Tu:gtp Ternary Complex gi|1942754|pdb|1TTT|A Chain A, Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Complex gi|1942755|pdb|1TTT|B Chain B, Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Complex gi|1942756|pdb|1TTT|C Chain C, Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Complex gi|2392582|pdb|1TUI|A Chain A, Intact Elongation Factor Tu In Complex With Gdp gi|2392583|pdb|1TUI|B Chain B, Intact Elongation Factor Tu In Complex With Gdp gi|2392584|pdb|1TUI|C Chain C, Intact Elongation Factor Tu In Complex With Gdp Length = 405 Score = 32.7 bits (73), Expect = 2.0 Identities = 22/60 (36%), Positives = 27/60 (44%), Gaps = 1/60 (1%) Frame = +3 Query: 93 TKAAEXEYGSSLSERXQFVGEFTGVRREGWAEV-DVKNKFSLGDSVEMMTPGGNVLFTLE 269 TK Y E + G FTG R + + DV L VEM+ PG NV FT+E Sbjct: 314 TKFEASVYILKKEEGGRHTGFFTGYRPQFYFRTTDVTGVVRLPQGVEMVMPGDNVTFTVE 373>gi|399423|sp|Q01698|EFTU_THEAQ Elongation factor Tu (EF-Tu) gi|478775|pir||S29293 translation elongation factor EF-Tu.A version 2 [validated] - Thermus aquaticus gi|49098|emb|CAA46998.1| (X66322) elongation factor Tu [Thermus aquaticus] Length = 406 Score = 32.7 bits (73), Expect = 2.0 Identities = 22/60 (36%), Positives = 27/60 (44%), Gaps = 1/60 (1%) Frame = +3 Query: 93 TKAAEXEYGSSLSERXQFVGEFTGVRREGWAEV-DVKNKFSLGDSVEMMTPGGNVLFTLE 269 TK Y E + G FTG R + + DV L VEM+ PG NV FT+E Sbjct: 315 TKFEASVYILKKEEGGRHTGFFTGYRPQFYFRTTDVTGVVRLPQGVEMVMPGDNVTFTVE 374>gi|15642087|ref|NP_231719.1| (NC_002505) 2-oxoglutarate dehydrogenase, E1 component [Vibrio cholerae] gi|11252270|pir||B82121 2-oxoglutarate dehydrogenase, E1 component VC2087 [imported] - Vibrio cholerae (group O1 strain N16961) gi|9656635|gb|AAF95233.1| (AE004282) 2-oxoglutarate dehydrogenase, E1 component [Vibrio cholerae] Length = 936 Score = 32.0 bits (71), Expect = 3.4 Identities = 17/38 (44%), Positives = 20/38 (51%) Frame = +3 Query: 153 EFTGVRREGWAEVDVKNKFSLGDSVEMMTPGGNVLFTL 266 EF G EGW DV K+ G S + TPGG+V L Sbjct: 284 EFAGKHGEGWGTGDV--KYHQGFSADFATPGGDVHLAL 319>gi|640371|pdb|1EFT| Elongation Factor Tu (Ef-Tu) Complexed With Guanosine-5'-(Beta,Gamma-Imido) Triphosphate (Gdpnp) Length = 405 Score = 31.6 bits (70), Expect = 4.4 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +3 Query: 93 TKAAEXEYGSSLSERXQFVGEFTGVRREGWAEV-DVKNKFSLGDSVEMMTPGGNVLFTLE 269 TK Y E + G F+G R + + DV L VEM+ PG NV FT+E Sbjct: 314 TKFEASVYVLKKEEGGRHTGFFSGYRPQFYFRTTDVTGVVRLPQGVEMVMPGDNVTFTVE 373>gi|8569263|pdb|1EXM|A Chain A, Crystal Structure Of Thermus Thermophilus Elongation Factor Tu (Ef-Tu) In Complex With The Gtp Analogue Gppnhp. gi|14488801|pdb|1HA3|A Chain A, Elongation Factor Tu In Complex With Aurodox gi|14488802|pdb|1HA3|B Chain B, Elongation Factor Tu In Complex With Aurodox Length = 405 Score = 31.6 bits (70), Expect = 4.4 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +3 Query: 93 TKAAEXEYGSSLSERXQFVGEFTGVRREGWAEV-DVKNKFSLGDSVEMMTPGGNVLFTLE 269 TK Y E + G F+G R + + DV L VEM+ PG NV FT+E Sbjct: 314 TKFEASVYVLKKEEGGRHTGFFSGYRPQFYFRTTDVTGVVQLPPGVEMVMPGDNVTFTVE 373>gi|2624675|pdb|1AIP|E Chain E, Ef-Tu Ef-Ts Complex From Thermus Thermophilus gi|2624671|pdb|1AIP|A Chain A, Ef-Tu Ef-Ts Complex From Thermus Thermophilus gi|2624672|pdb|1AIP|B Chain B, Ef-Tu Ef-Ts Complex From Thermus Thermophilus gi|2624676|pdb|1AIP|F Chain F, Ef-Tu Ef-Ts Complex From Thermus Thermophilus Length = 405 Score = 31.6 bits (70), Expect = 4.4 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +3 Query: 93 TKAAEXEYGSSLSERXQFVGEFTGVRREGWAEV-DVKNKFSLGDSVEMMTPGGNVLFTLE 269 TK Y E + G F+G R + + DV L VEM+ PG NV FT+E Sbjct: 314 TKFEASVYVLKKEEGGRHTGFFSGYRPQFYFRTTDVTGVVQLPPGVEMVMPGDNVTFTVE 373>gi|119215|sp|P07157|EFTU_THETH Elongation factor Tu (EF-Tu) gi|77584|pir||S00229 translation elongation factor EF-Tu.A version 1 [validated] - Thermus aquaticus gi|48286|emb|CAA29856.1| (X06657) elongation factor Tu (AA 1-406) [Thermus thermophilus] gi|225912|prf||1403291A tuf gene [Thermus thermophilus] Length = 406 Score = 31.6 bits (70), Expect = 4.4 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +3 Query: 93 TKAAEXEYGSSLSERXQFVGEFTGVRREGWAEV-DVKNKFSLGDSVEMMTPGGNVLFTLE 269 TK Y E + G F+G R + + DV L VEM+ PG NV FT+E Sbjct: 315 TKFEASVYVLKKEEGGRHTGFFSGYRPQFYFRTTDVTGVVQLPPGVEMVMPGDNVTFTVE 374>gi|94735|pir||S17146 translation elongation factor EF-Tu.B [validated] - Thermus aquaticus gi|312960|emb|CAA43956.1| (X61957) elongation factor Tu [Thermus thermophilus] gi|228025|prf||1715213A elongation factor Tu [Thermus thermophilus] Length = 406 Score = 31.6 bits (70), Expect = 4.4 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +3 Query: 93 TKAAEXEYGSSLSERXQFVGEFTGVRREGWAEV-DVKNKFSLGDSVEMMTPGGNVLFTLE 269 TK Y E + G F+G R + + DV L VEM+ PG NV FT+E Sbjct: 315 TKFEASVYVLKKEEGGRHTGFFSGYRPQFYFRTTDVTGVVQLPPGVEMVMPGDNVTFTVE 374>gi|48288|emb|CAA29397.1| (X05977) elongation factor Tu (AA 1 - 406) [Thermus thermophilus] Length = 406 Score = 31.6 bits (70), Expect = 4.4 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +3 Query: 93 TKAAEXEYGSSLSERXQFVGEFTGVRREGWAEV-DVKNKFSLGDSVEMMTPGGNVLFTLE 269 TK Y E + G F+G R + + DV L VEM+ PG NV FT+E Sbjct: 315 TKFEASVYVLKKEEGGRHTGFFSGYRPQFYFRTTDVTGVVQLPPGVEMVMPGDNVTFTVE 374>gi|15639017|ref|NP_218463.1| (NC_000919) sodium- and chloride- dependent transporter [Treponema pallidum] gi|7441670|pir||C71376 probable sodium- and chloride- dependent transporter - syphilis spirochete gi|3322276|gb|AAC65017.1| (AE001187) sodium- and chloride- dependent transporter [Treponema pallidum] Length = 443 Score = 31.2 bits (69), Expect = 5.7 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -3 Query: 322 WPLPGATSIGSPFLFCMLSRVNSTLPPGVIISTL 221 W L S G FLF ++RV S +P GV+IS L Sbjct: 280 WVLGMDVSSGPEFLFVTITRVASQIPMGVMISVL 313>gi|17935561|ref|NP_532351.1| (NC_003304) conserved hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] gi|17740100|gb|AAL42667.1| (AE009123) conserved hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] Length = 50 Score = 30.8 bits (68), Expect = 7.5 Identities = 10/29 (34%), Positives = 21/29 (71%) Frame = -2 Query: 374 QQCIIEINILRDRQINDMAVARRDLNRLA 288 +Q + E+ + DR++ND+ + R+D+ R+A Sbjct: 16 RQTVTELGRMSDRELNDLGIGRQDIRRVA 44>gi|12802635|gb|AAK08017.1|AF319527_1 (AF319527) Col [Neisseria meningitidis] gi|12802642|gb|AAK08023.1|AF319528_4 (AF319528) Col [Neisseria meningitidis] Length = 41 Score = 30.4 bits (67), Expect = 9.8 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +3 Query: 264 LESMQNKKGEPIEVAPGNGHIVYLP 338 LE M +KG+P++VAPGNG V +P Sbjct: 2 LEQM-TRKGQPVDVAPGNGIQVKIP 25Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Feb 27, 2002 3:31 AM Number of letters in database: 277,845,443 Number of sequences in database: 0 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 123,288,978 Number of Sequences: 0 Number of extensions: 2423457 Number of successful extensions: 5952 Number of sequences better than 10.0: 68 Number of HSP's better than 10.0 without gapping: 5796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5945 length of database: 73,581,270 effective HSP length: 113 effective length of database: 46,280,922 effective search space used: 12634691706 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)