Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.RID: 1014228962-13633-2659
Query= 7D1_131_132BLASTX (646 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 883,557 sequences; 276,611,002 total letters
If you have any problems or questions with the results of this search
please refer to the BLAST FAQsScore E Sequences producing significant alignments: (bits) Value gi|16763661|ref|NP_459276.1| (NC_003197) putative periplasm... 49 1e-05 gi|16121825|ref|NP_405138.1| (NC_003143) putative exported ... 45 1e-04 gi|17548756|ref|NP_522096.1| (NC_003296) PROBABLE TRANSCRIP... 31 2.4 gi|15791619|ref|NP_281442.1| (NC_002163) hypothetical prote... 31 2.4 gi|12329060|emb|CAC05791.1| (AL391753) ORF81, length = 296 ... 30 4.0 gi|17229666|ref|NP_486214.1| (NC_003272) transcriptional re... 29 9.0 gi|15676495|ref|NP_273634.1| (NC_003112) tRNA (guanine-N1)-... 29 9.0 gi|15639682|ref|NP_219132.1| (NC_000919) phosphoribosylglyc... 29 9.0 gi|321666|pir||S32171 hydroxyneurosporene dehydrogenase (EC... 29 9.0Alignments >gi|16763661|ref|NP_459276.1| (NC_003197) putative periplasmic protein [Salmonella typhimurium LT2] gi|16418778|gb|AAL19235.1| (AE008707) putative periplasmic protein [Salmonella typhimurium LT2] Length = 127 Score = 48.9 bits (115), Expect = 1e-05 Identities = 27/103 (26%), Positives = 48/103 (46%) Frame = -2 Query: 312 TYFLMSLLLGSHVVLAENSLNALSQEALYKNWLTSRCIGKSTDSERTKQDAFRSASAYLE 133 T+ + +L+ E SQ L KNW S C+ + K DA +ASAYLE Sbjct: 12 TFSISGMLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLE 71 Query: 132 LSKLPMDAFELXIXWPGEKLAEQYANKNSQGSVQGTYHTLDCL 4 K ++ + +++A++Y+ GS+ ++T+ C+ Sbjct: 72 YGKQSVEIYHEI-----DEIAKKYSGLKYNGSISSDFNTMKCI 109>gi|16121825|ref|NP_405138.1| (NC_003143) putative exported protein [Yersinia pestis] gi|15979595|emb|CAC90375.1| (AJ414149) putative exported protein [Yersinia pestis] Length = 144 Score = 45.4 bits (106), Expect = 1e-04 Identities = 26/48 (54%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = -2 Query: 531 EAHTAVRALAKEFLAKPYDSMSGEP-MTMAKCIDLVHSQELQAIIKKY 391 EA+ V LAK+FL K Y S +GE +T+ KCIDL S EL AI KY Sbjct: 93 EAYEEVSELAKKFLEKKYISKNGESKLTVMKCIDLSQSSELSAIKDKY 140Score = 40.0 bits (92), Expect = 0.005 Identities = 21/86 (24%), Positives = 42/86 (48%) Frame = -2 Query: 291 LLGSHVVLAENSLNALSQEALYKNWLTSRCIGKSTDSERTKQDAFRSASAYLELSKLPMD 112 L+ + AE + N + Q+ +N+ S C+ + +AF + AY+EL P++ Sbjct: 34 LISFSTLAAEVNQNKVQQKNNLENFALSICLAEGFPDGEINSEAFSAVGAYVELGAYPVE 93 Query: 111 AFELXIXWPGEKLAEQYANKNSQGSV 34 A+E + L ++Y +KN + + Sbjct: 94 AYEEVSELAKKFLEKKYISKNGESKL 119>gi|17548756|ref|NP_522096.1| (NC_003296) PROBABLE TRANSCRIPTION REGULATOR PROTEIN [Ralstonia solanacearum] gi|17431005|emb|CAD17686.1| (AL646079) PROBABLE TRANSCRIPTION REGULATOR PROTEIN [Ralstonia solanacearum] Length = 303 Score = 31.2 bits (69), Expect = 2.4 Identities = 19/69 (27%), Positives = 35/69 (50%) Frame = +3 Query: 207 GWLTNFYKVPLAIKH*ASFQQGLHGFRAAETLKSTCIFSSEITFDMSRRLSNSDISCRLF 386 G L +F L ++ + Q + G R A+ ++S S+ TFD+ +R + D++ Sbjct: 43 GQLEDFLGRQLFLREPRALQLTVAGQRYADRVRSQLEACSDATFDVMKRYGDLDLALACS 102 Query: 387 LGIS**WLA 413 G++ WLA Sbjct: 103 SGVATLWLA 111>gi|15791619|ref|NP_281442.1| (NC_002163) hypothetical protein Cj0248 [Campylobacter jejuni] gi|11290197|pir||G81442 hypothetical protein Cj0248 [imported] - Campylobacter jejuni (strain NCTC 11168) gi|6967725|emb|CAB72716.1| (AL139074) hypothetical protein Cj0248 [Campylobacter jejuni] Length = 285 Score = 31.2 bits (69), Expect = 2.4 Identities = 18/60 (30%), Positives = 32/60 (53%) Frame = -2 Query: 600 LSKEVKTMPPPPLGVPGIRRLFSEAHTAVRALAKEFLAKPYDSMSGEPMTMAKCIDLVHS 421 L K V+ +PP P V +R+ SEA++ + + K + +S +P+ AK + L +S Sbjct: 9 LLKSVEVLPPLPDTVSKLRKYVSEANSNIETM------KVAEIISSDPLMTAKLLQLANS 62>gi|12329060|emb|CAC05791.1| (AL391753) ORF81, length = 296 aa, similarities with transcriptional activators of the AraC family [Shigella flexneri] Length = 296 Score = 30.4 bits (67), Expect = 4.0 Identities = 19/74 (25%), Positives = 38/74 (50%), Gaps = 2/74 (2%) Frame = -2 Query: 351 DGSYQRLSRMRRYTYFLMSLLLGSHVVLAENSLNALSQEALYKNWLTSRCIGKSTDSERT 172 D +RL ++ + L+ +V++ +S+ E +WL S+C + TD+++T Sbjct: 103 DHDIERLKKISK-----AQLISPDYVLIDFSSVGGGGDEPYAMSWLISQCAHQCTDNKKT 157 Query: 171 KQDAF--RSASAYL 136 + DA + S+YL Sbjct: 158 ETDAIYDKVRSSYL 171>gi|17229666|ref|NP_486214.1| (NC_003272) transcriptional regulator [Nostoc sp. PCC 7120] gi|17131265|dbj|BAB73873.1| (AP003588) transcriptional regulator [Nostoc sp. PCC 7120] Length = 331 Score = 29.3 bits (64), Expect = 9.0 Identities = 14/41 (34%), Positives = 23/41 (55%) Frame = -2 Query: 540 LFSEAHTAVRALAKEFLAKPYDSMSGEPMTMAKCIDLVHSQ 418 +F EA TAV +A++ + PY+ M+ K I+L+ Q Sbjct: 161 IFPEATTAVNLVARQIINCPYEGMTKRMYLQGKVIELMALQ 201>gi|15676495|ref|NP_273634.1| (NC_003112) tRNA (guanine-N1)-methyltransferase [Neisseria meningitidis MC58] gi|11256657|pir||C81180 tRNA (guanine-N1)-methyltransferase NMB0590 [imported] - Neisseria meningitidis (group B strain MD58) gi|7225820|gb|AAF41018.1| (AE002415) tRNA (guanine-N1)-methyltransferase [Neisseria meningitidis MC58] Length = 249 Score = 29.3 bits (64), Expect = 9.0 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 3/70 (4%) Frame = -2 Query: 561 GVPGIRRLFSEAHTAV---RALAKEFLAKPYDSMSGEPMTMAKCIDLVHSQELQAIIKKY 391 G PG+ + H A+ + + + Y S G+P+T K ++L L + +Y Sbjct: 56 GGPGMIMMAPPLHAAIEHAKTQSSQAAKVIYLSPQGKPLTHQKAVELAELPHLILLCGRY 115 Query: 390 QGKDDN*YQS 361 +G D+ QS Sbjct: 116 EGIDERLLQS 125>gi|15639682|ref|NP_219132.1| (NC_000919) phosphoribosylglycinamide formyltransferase, putative [Treponema pallidum] gi|7521310|pir||D71293 probable phosphoribosylglycinamide formyltransferase - syphilis spirochete gi|3322997|gb|AAC65662.1| (AE001243) phosphoribosylglycinamide formyltransferase, putative [Treponema pallidum] Length = 597 Score = 29.3 bits (64), Expect = 9.0 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -2 Query: 555 PGIRRLFSEAHTAVRALAKEFLAKPYDSMSGEPMTMAKCID 433 PG RL S H+A L+ + KP D+M T+A+C D Sbjct: 137 PGHARLCSHLHSA--GLSFPLVVKPTDNMGARGCTLAQCKD 175>gi|321666|pir||S32171 hydroxyneurosporene dehydrogenase (EC 1.3.-.-) - Myxococcus xanthus gi|288223|emb|CAA79958.1| (Z21955) hydroxyneurosporene dehydrogenase [Myxococcus xanthus] Length = 485 Score = 29.3 bits (64), Expect = 9.0 Identities = 18/56 (32%), Positives = 28/56 (49%), Gaps = 5/56 (8%) Frame = -2 Query: 594 KEVKTMPPPPLGV-----PGIRRLFSEAHTAVRALAKEFLAKPYDSMSGEPMTMAK 442 K+V+ M GV GIR ++EA RA + +L P++ M+G +AK Sbjct: 102 KDVERMAESAAGVRPGERDGIRGFYTEAAAIWRAAGEPYLEAPFEGMAGFMTRVAK 157Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Feb 19, 2002 1:20 AM Number of letters in database: 276,611,002 Number of sequences in database: 0 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,072,845 Number of Sequences: 0 Number of extensions: 1515729 Number of successful extensions: 4449 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 4213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4448 length of database: 74,780,689 effective HSP length: 107 effective length of database: 48,534,766 effective search space used: 5193219962 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)