Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.RID: 1015586591-14283-6842
Query= 22D9_131_132_BLASTX (965 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 891,607 sequences; 279,182,324 total letters
If you have any problems or questions with the results of this search
please refer to the BLAST FAQsScore E Sequences producing significant alignments: (bits) Value gi|16763661|ref|NP_459276.1| (NC_003197) putative periplasm... 55 3e-07 gi|16121825|ref|NP_405138.1| (NC_003143) putative exported ... 42 3e-04 gi|15601849|ref|NP_233480.1| (NC_002506) ABC transporter, p... 32 2.0 gi|12329060|emb|CAC05791.1| (AL391753) ORF81, length = 296 ... 30 7.8Alignments >gi|16763661|ref|NP_459276.1| (NC_003197) putative periplasmic protein [Salmonella typhimurium LT2] gi|16418778|gb|AAL19235.1| (AE008707) putative periplasmic protein [Salmonella typhimurium LT2] Length = 127 Score = 55.1 bits (131), Expect = 3e-07 Identities = 27/97 (27%), Positives = 48/97 (48%) Frame = +1 Query: 595 TYFLMSLLLGSHVVLAENSLNALSQEALYKNWLTSRCIGKSTDSERTKQDAFRSASAYLE 774 T+ + +L+ E SQ L KNW S C+ + K DA +ASAYLE Sbjct: 12 TFSISGMLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLE 71 Query: 775 LSKLPMDAFEQGEKLAEQYANKNSQGSVQGTYHTLDC 885 K ++ + + +++A++Y+ GS+ ++T+ C Sbjct: 72 YGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKC 108Score = 33.9 bits (76), Expect = 0.70 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = +3 Query: 261 ALSVCIAEGYSAKEVKNDXXXXXRGYTEFGDYSLEAAYRRQGAGKRISG 407 ALS C+A Y VKND Y E+G S+E + K+ SG Sbjct: 44 ALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIAKKYSG 92>gi|16121825|ref|NP_405138.1| (NC_003143) putative exported protein [Yersinia pestis] gi|15979595|emb|CAC90375.1| (AJ414149) putative exported protein [Yersinia pestis] Length = 144 Score = 42.0 bits (97), Expect = 0.003 Identities = 20/75 (26%), Positives = 40/75 (52%) Frame = +1 Query: 616 LLGSHVVLAENSLNALSQEALYKNWLTSRCIGKSTDSERTKQDAFRSASAYLELSKLPMD 795 L+ + AE + N + Q+ +N+ S C+ + +AF + AY+EL P++ Sbjct: 34 LISFSTLAAEVNQNKVQQKNNLENFALSICLAEGFPDGEINSEAFSAVGAYVELGAYPVE 93 Query: 796 AFEQGEKLAEQYANK 840 A+E+ +LA+++ K Sbjct: 94 AYEEVSELAKKFLEK 108Score = 34.7 bits (78), Expect(2) = 3e-04 Identities = 14/36 (38%), Positives = 21/36 (57%) Frame = +3 Query: 261 ALSVCIAEGYSAKEVKNDXXXXXRGYTEFGDYSLEA 368 ALS+C+AEG+ E+ ++ Y E G Y +EA Sbjct: 59 ALSICLAEGFPDGEINSEAFSAVGAYVELGAYPVEA 94Score = 29.6 bits (65), Expect(2) = 3e-04 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +1 Query: 379 VRALAKEFLAKPYDSMSGE-PMTMAKCIVLTKXRLVTA 489 V LAK+FL K Y S +GE +T+ KCI L++ ++A Sbjct: 98 VSELAKKFLEKKYISKNGESKLTVMKCIDLSQSSELSA 135>gi|15601849|ref|NP_233480.1| (NC_002506) ABC transporter, permease protein [Vibrio cholerae] gi|11354371|pir||G82377 ABC transporter, permease protein VCA1100 [imported] - Vibrio cholerae (group O1 strain N16961) gi|9658547|gb|AAF96992.1| (AE004435) ABC transporter, permease protein [Vibrio cholerae] Length = 270 Score = 32.3 bits (72), Expect = 2.0 Identities = 19/55 (34%), Positives = 23/55 (41%) Frame = +2 Query: 56 PGWNDPADTQHYGTXNLLRSLLLSKIQRGIYMVTKIKSLCVASMIFLGCIQSAQA 220 P W +P T HYG N R L S I + M CV+S LG + A Sbjct: 53 PSWGEPLGTDHYGRSNFAR--LSSAIATSLTMAV----ACVSSSALLGLVTGVVA 101>gi|12329060|emb|CAC05791.1| (AL391753) ORF81, length = 296 aa, similarities with transcriptional activators of the AraC family [Shigella flexneri] Length = 296 Score = 30.4 bits (67), Expect = 7.8 Identities = 19/74 (25%), Positives = 38/74 (50%), Gaps = 2/74 (2%) Frame = +1 Query: 556 DGSYQRLSRMRRYTYFLMSLLLGSHVVLAENSLNALSQEALYKNWLTSRCIGKSTDSERT 735 D +RL ++ + L+ +V++ +S+ E +WL S+C + TD+++T Sbjct: 103 DHDIERLKKISK-----AQLISPDYVLIDFSSVGGGGDEPYAMSWLISQCAHQCTDNKKT 157 Query: 736 KQDAF--RSASAYL 771 + DA + S+YL Sbjct: 158 ETDAIYDKVRSSYL 171Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 6, 2002 1:29 AM Number of letters in database: 279,182,324 Number of sequences in database: 0 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 116,368,016 Number of Sequences: 0 Number of extensions: 2231893 Number of successful extensions: 5983 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 5698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5940 length of database: 74,921,317 effective HSP length: 111 effective length of database: 47,640,292 effective search space used: 10004461320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)