Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.RID: 1015589058-13233-11619
Query= 21C1_1248_131_132_BLASTX (1248 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 891,607 sequences; 279,182,324 total letters
If you have any problems or questions with the results of this search
please refer to the BLAST FAQsScore E Sequences producing significant alignments: (bits) Value gi|281920|pir||S28007 probable ATP-binding protein - Escher... 41 0.008 gi|15901108|ref|NP_345712.1| (NC_003028) conserved hypothet... 39 0.024 gi|15903169|ref|NP_358719.1| (NC_003098) chromosome condens... 39 0.024 gi|15674632|ref|NP_268806.1| (NC_002737) putative chromosom... 37 0.090 gi|17865482|sp|P58481|HTPG_STRCO Chaperone protein htpG (He... 37 0.090 gi|17934801|ref|NP_531591.1| (NC_003304) ABC transporter, n... 37 0.12 gi|15888233|ref|NP_353914.1| (NC_003062) AGR_C_1628p [Agrob... 37 0.12 gi|16799384|ref|NP_469652.1| (NC_003212) similar to ABC tra... 37 0.15 gi|8894821|emb|CAB96017.1| (AL360055) putative ABC transpor... 36 0.20 gi|13096783|pdb|1E69|A Chain A, Smc Head Domain From Thermo... 36 0.26 gi|15643938|ref|NP_228987.1| (NC_000853) chromosome segrega... 36 0.26 gi|15642383|ref|NP_232016.1| (NC_002505) conserved hypothet... 36 0.26 gi|5830765|emb|CAB54591.1| (AJ249205) putative ATP binding ... 36 0.26 gi|15644384|ref|NP_229436.1| (NC_000853) conserved hypothet... 35 0.34 gi|16801701|ref|NP_471969.1| (NC_003212) similar to phospha... 35 0.44 gi|16804534|ref|NP_466019.1| (NC_003210) similar to phospha... 35 0.44 gi|15616533|ref|NP_244839.1| (NC_002570) ABC transporter re... 35 0.44 gi|16800310|ref|NP_470578.1| (NC_003212) similar to bacteri... 35 0.44 gi|15827858|ref|NP_302121.1| (NC_002677) possible cell divi... 35 0.44 gi|15807275|ref|NP_296005.1| (NC_001263) manganese ABC tran... 35 0.58 gi|5690058|emb|CAB51943.1| (AJ243915) excinuclease, subunit... 35 0.58 gi|15894078|ref|NP_347427.1| (NC_003030) Ferrichrome ABC tr... 35 0.58 gi|16030073|emb|CAC93883.1| (AJ414608) SMC protein [Lactoco... 34 0.76 gi|17986722|ref|NP_539356.1| (NC_003317) GLYCINE BETAINE/L-... 34 0.76 gi|15891516|ref|NP_357188.1| (NC_003063) AGR_L_2810p [Agrob... 34 0.76 gi|15672785|ref|NP_266959.1| (NC_002662) chromosome segrega... 34 0.76 gi|15606250|ref|NP_213628.1| (NC_000918) cell division prot... 34 0.76 gi|7480379|pir||T36437 probable ABC-type transport system A... 34 0.99 gi|15842466|ref|NP_337503.1| (NC_002755) chromosome segrega... 34 0.99 gi|227063|prf||1613432A uvrA gene [Micrococcus luteus] 34 0.99 gi|137187|sp|P13567|UVRA_MICLU Excinuclease ABC subunit A >... 34 0.99 gi|2492564|sp|Q56242|UVRA_THETH Excinuclease ABC subunit A ... 34 0.99 gi|15799835|ref|NP_285847.1| (NC_002655) ATP-binding compon... 34 0.99 gi|7480555|pir||T35661 probable chromosome associated prote... 34 0.99 gi|145950|gb|AAB61769.1| (M12486) fhuC [Escherichia coli] >... 34 0.99 gi|16128144|ref|NP_414693.1| (NC_000913) ATP-binding compon... 34 0.99 gi|2108228|gb|AAC45331.1| (U97348) ATP-binding protein homo... 34 0.99 gi|15610059|ref|NP_217438.1| (NC_000962) smc [Mycobacterium... 34 0.99 gi|16121594|ref|NP_404907.1| (NC_003143) putative sideropho... 33 1.3 gi|15601993|ref|NP_245065.1| (NC_002663) FecE [Pasteurella ... 33 1.3 gi|17228623|ref|NP_485171.1| (NC_003272) chromosome segrega... 33 1.3 gi|41440|emb|CAA29254.1| (X05810) fhuC product (AA 1-265) [... 33 1.3 gi|9929261|emb|CAC05300.1| (AJ293860) hypothetical protein;... 33 1.3 gi|16121625|ref|NP_404938.1| (NC_003143) putative transport... 33 1.7 gi|16803999|ref|NP_465484.1| (NC_003210) similar to ferrich... 33 1.7 gi|16801140|ref|NP_471408.1| (NC_003212) similar to ferrich... 33 1.7 gi|10957420|ref|NP_051651.1| (NC_000958) iron ABC transport... 33 1.7 gi|16273449|ref|NP_439698.1| (NC_000907) ABC transporter, A... 33 1.7 gi|15612878|ref|NP_241181.1| (NC_002570) BH0315~unknown con... 33 1.7 gi|17937740|ref|NP_534529.1| (NC_003305) ABC transporter, n... 33 1.7Alignments >gi|281920|pir||S28007 probable ATP-binding protein - Escherichia coli gi|42502|emb|CAA78294.1| (Z12832) hypothetical ATP binding protein [Escherichia coli] Length = 492 Score = 40.8 bits (94), Expect = 0.008 Identities = 19/55 (34%), Positives = 33/55 (59%) Frame = -1 Query: 969 MAARQNIPAQLRLKEIQIQSLKGISNCTITFPADSKVTAIMGMNGSGKSTIIHAL 805 ++A+Q QLR+ +I +++ KG + + F T ++G NG GKSTI+ A+ Sbjct: 51 LSAKQLEGGQLRVADIHLENYKGFESLIMDFSMKKNSTILVGNNGCGKSTILDAI 105>gi|15901108|ref|NP_345712.1| (NC_003028) conserved hypothetical protein [Streptococcus pneumoniae TIGR4] gi|14972729|gb|AAK75352.1| (AE007424) conserved hypothetical protein [Streptococcus pneumoniae TIGR4] Length = 1179 Score = 39.3 bits (90), Expect = 0.024 Identities = 23/47 (48%), Positives = 31/47 (65%), Gaps = 1/47 (2%) Frame = -1 Query: 933 LKEIQIQSLKGISNCT-ITFPADSKVTAIMGMNGSGKSTIIHALAFA 796 LKEI+IQ K ++ T + F D VTA++G NGSGKS I +L +A Sbjct: 3 LKEIEIQGFKSFADKTKVVF--DQGVTAVVGPNGSGKSNITESLRWA 47>gi|15903169|ref|NP_358719.1| (NC_003098) chromosome condensation and segregation SMC protein [Streptococcus pneumoniae R6] gi|15458753|gb|AAK99929.1| (AE008485) chromosome condensation and segregation SMC protein [Streptococcus pneumoniae R6] Length = 1179 Score = 39.3 bits (90), Expect = 0.024 Identities = 23/47 (48%), Positives = 31/47 (65%), Gaps = 1/47 (2%) Frame = -1 Query: 933 LKEIQIQSLKGISNCT-ITFPADSKVTAIMGMNGSGKSTIIHALAFA 796 LKEI+IQ K ++ T + F D VTA++G NGSGKS I +L +A Sbjct: 3 LKEIEIQGFKSFADKTKVVF--DQGVTAVVGPNGSGKSNITESLRWA 47>gi|15674632|ref|NP_268806.1| (NC_002737) putative chromosome segregation SMC protein [Streptococcus pyogenes] [Streptococcus pyogenes M1 GAS] gi|13621745|gb|AAK33527.1| (AE006510) putative chromosome segregation SMC protein [Streptococcus pyogenes M1 GAS] Length = 1179 Score = 37.4 bits (85), Expect = 0.090 Identities = 20/46 (43%), Positives = 29/46 (62%) Frame = -1 Query: 933 LKEIQIQSLKGISNCTITFPADSKVTAIMGMNGSGKSTIIHALAFA 796 LKEI+++ K ++ T D VTA++G NGSGKS I +L +A Sbjct: 3 LKEIELEGFKSFADKT-KIEFDKGVTAVVGPNGSGKSNITESLRWA 47>gi|17865482|sp|P58481|HTPG_STRCO Chaperone protein htpG (Heat shock protein htpG) (High temperature protein G) gi|14495026|emb|CAC42143.1| (AL592126) heat shock protein [Streptomyces coelicolor] Length = 638 Score = 37.4 bits (85), Expect = 0.090 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -3 Query: 730 HVDNNWRDSGFTAHFYA-GTLNNQSNKILFVPTQAPNDTFTQPYYK 596 H+ ++WRD T A GT Q+ +LFVP+ AP+D FTQ Y + Sbjct: 261 HIAHDWRDPLETIRLQAEGTFEYQA--LLFVPSHAPHDLFTQGYQR 304>gi|17934801|ref|NP_531591.1| (NC_003304) ABC transporter, nucleotide binding/ATPase protein [Agrobacterium tumefaciens str. C58 (U. Washington)] gi|17739271|gb|AAL41907.1| (AE009054) ABC transporter, nucleotide binding/ATPase protein [Agrobacterium tumefaciens str. C58 (U. Washington)] Length = 365 Score = 37.0 bits (84), Expect = 0.12 Identities = 16/30 (53%), Positives = 23/30 (76%) Frame = -1 Query: 903 GISNCTITFPADSKVTAIMGMNGSGKSTII 814 G++N IT P K+T +MG++GSGKST+I Sbjct: 43 GLNNINITMPG-GKITVVMGLSGSGKSTLI 71>gi|15888233|ref|NP_353914.1| (NC_003062) AGR_C_1628p [Agrobacterium tumefaciens] [Agrobacterium tumefaciens str. C58 (Cereon)] gi|15155885|gb|AAK86699.1| (AE008020) AGR_C_1628p [Agrobacterium tumefaciens str. C58 (Cereon)] Length = 384 Score = 37.0 bits (84), Expect = 0.12 Identities = 16/30 (53%), Positives = 23/30 (76%) Frame = -1 Query: 903 GISNCTITFPADSKVTAIMGMNGSGKSTII 814 G++N IT P K+T +MG++GSGKST+I Sbjct: 62 GLNNINITMPG-GKITVVMGLSGSGKSTLI 90>gi|16799384|ref|NP_469652.1| (NC_003212) similar to ABC transporters (ATP-binding protein) [Listeria innocua] gi|16412736|emb|CAC95540.1| (AL596164) similar to ABC transporters (ATP-binding protein) [Listeria innocua] Length = 219 Score = 36.6 bits (83), Expect = 0.15 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = -1 Query: 900 ISNCTITFPADSKVTAIMGMNGSGKSTIIHALA 802 I+N +IT + K+T I GMNGSGKST+ +A Sbjct: 21 INNLSITINFNRKITLITGMNGSGKSTLAKIIA 53>gi|8894821|emb|CAB96017.1| (AL360055) putative ABC transport system ATP-binding protein [Streptomyces coelicolor A3(2)] Length = 249 Score = 36.2 bits (82), Expect = 0.20 Identities = 19/39 (48%), Positives = 28/39 (71%) Frame = -1 Query: 918 IQSLKGISNCTITFPADSKVTAIMGMNGSGKSTIIHALA 802 +++L G+S + FPA + TAIMG +GSGKST++H A Sbjct: 27 VRALDGVS---VDFPA-GRFTAIMGPSGSGKSTLMHCAA 61>gi|13096783|pdb|1E69|A Chain A, Smc Head Domain From Thermotoga Maritima gi|13096784|pdb|1E69|B Chain B, Smc Head Domain From Thermotoga Maritima gi|13096785|pdb|1E69|C Chain C, Smc Head Domain From Thermotoga Maritima gi|13096786|pdb|1E69|D Chain D, Smc Head Domain From Thermotoga Maritima gi|13096787|pdb|1E69|E Chain E, Smc Head Domain From Thermotoga Maritima gi|13096788|pdb|1E69|F Chain F, Smc Head Domain From Thermotoga Maritima Length = 322 Score = 35.8 bits (81), Expect = 0.26 Identities = 19/45 (42%), Positives = 30/45 (66%) Frame = -1 Query: 939 LRLKEIQIQSLKGISNCTITFPADSKVTAIMGMNGSGKSTIIHAL 805 +RLK++ ++ K ++ +D +VTAI+G NGSGKS II A+ Sbjct: 1 MRLKKLYLKGFKSFGRPSLIGFSD-RVTAIVGPNGSGKSNIIDAI 44Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Mar 6, 2002 1:29 AM Number of letters in database: 279,182,324 Number of sequences in database: 0 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 153,848,937 Number of Sequences: 0 Number of extensions: 3034211 Number of successful extensions: 9732 Number of sequences better than 10.0: 188 Number of HSP's better than 10.0 without gapping: 9323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9732 length of database: 74,921,317 effective HSP length: 114 effective length of database: 46,902,967 effective search space used: 14117793067 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)