BLASTX 2.2.3 [Apr-24-2002]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1030631336-05970-8432 Query= 10H1_131_132BLASTX (909 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,039,285 sequences; 328,747,273 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports Score E Sequences producing significant alignments: (bits) Value gi|1778510|gb|AAB40793.1| (U82598) isochorismate synthase [... 72 2e-12 gi|15800308|ref|NP_286320.1| (NC_002655) isochorismate hydr... 72 2e-12 gi|145840|gb|AAA18491.1| (M36700) iron chelator protein [Es... 72 2e-12 gi|223154|prf||0601198A polymerase beta,RNA [Escherichia coli] 35 0.26 gi|16128566|ref|NP_415115.1| (NC_000913) enterochelin synth... 31 4.8 gi|15800297|ref|NP_286309.1| (NC_002655) enterobactin synth... 31 4.8 gi|6018425|emb|CAB57861.1| (X17426) enterobactin [Escherich... 31 4.8 gi|78421|pir||JV0078 entD protein - Escherichia coli >gi|16... 31 4.8 gi|1778499|gb|AAB40782.1| (U82598) enterobactin synthetase ... 31 4.8
Alignments
>gi|1778510|gb|AAB40793.1| (U82598) isochorismate synthase [Escherichia coli] Length = 395 Score = 72.4 bits (176), Expect = 2e-12 Identities = 36/87 (41%), Positives = 49/87 (55%) Frame = +3 Query: 579 FLYRSEFRSLSADGVFERIETPAFGGEQEGSALAQHIRQALARAKAAGQETPVVVGAIPF 758 F + S +RS + G F R + PA G+ S Q + A AKA G + PV+VGAIPF Sbjct: 25 FFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAALFADAKAQGIKNPVMVGAIPF 84 Query: 759 DTRRPSCLYVPENCQFVANDSFTRAAR 839 D R+PS LY+PE+ Q + +AR Sbjct: 85 DPRQPSSLYIPESWQSFSRQEKQASAR 111 >gi|15800308|ref|NP_286320.1| (NC_002655) isochorismate hydroxymutase 2, enterochelin biosynthesis [Escherichia coli O157:H7 EDL933] gi|15829886|ref|NP_308659.1| (NC_002695) isochorismate hydroxymutase 2 [Escherichia coli O157:H7] gi|16128576|ref|NP_415125.1| (NC_000913) isochorismate hydroxymutase 2, enterochelin biosynthesis [Escherichia coli K12] gi|585097|sp|P10377|ENTC_ECOLI Isochorismate synthase entC (Isochorismate mutase) gi|68479|pir||SYECIK isochorismate synthase (EC 5.4.99.6) [validated] - Escherichia coli gi|450376|gb|AAA16100.1| (M24142) isochorismate synthase [Escherichia coli] gi|1786809|gb|AAC73694.1| (AE000165) isochorismate hydroxymutase 2, enterochelin biosynthesis [Escherichia coli K12] gi|12513486|gb|AAG54928.1|AE005239_3 (AE005239) isochorismate hydroxymutase 2, enterochelin biosynthesis [Escherichia coli O157:H7 EDL933] gi|13360090|dbj|BAB34055.1| (AP002552) isochorismate hydroxymutase 2 [Escherichia coli O157:H7] Length = 391 Score = 72.4 bits (176), Expect = 2e-12 Identities = 36/87 (41%), Positives = 49/87 (55%) Frame = +3 Query: 579 FLYRSEFRSLSADGVFERIETPAFGGEQEGSALAQHIRQALARAKAAGQETPVVVGAIPF 758 F + S +RS + G F R + PA G+ S Q + A AKA G + PV+VGAIPF Sbjct: 21 FFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAALFADAKAQGIKNPVMVGAIPF 80 Query: 759 DTRRPSCLYVPENCQFVANDSFTRAAR 839 D R+PS LY+PE+ Q + +AR Sbjct: 81 DPRQPSSLYIPESWQSFSRQEKQASAR 107 >gi|145840|gb|AAA18491.1| (M36700) iron chelator protein [Escherichia coli] Length = 391 Score = 72.4 bits (176), Expect = 2e-12 Identities = 36/87 (41%), Positives = 49/87 (55%) Frame = +3 Query: 579 FLYRSEFRSLSADGVFERIETPAFGGEQEGSALAQHIRQALARAKAAGQETPVVVGAIPF 758 F + S +RS + G F R + PA G+ S Q + A AKA G + PV+VGAIPF Sbjct: 21 FFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAALFADAKAQGIKNPVMVGAIPF 80 Query: 759 DTRRPSCLYVPENCQFVANDSFTRAAR 839 D R+PS LY+PE+ Q + +AR Sbjct: 81 DPRQPSSLYIPESWQSFSRQEKQASAR 107 >gi|223154|prf||0601198A polymerase beta,RNA [Escherichia coli] Length = 253 Score = 35.4 bits (80), Expect = 0.26 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = +1 Query: 763 RAGLPACTCLKTASLSPTTALPAPRARCCNSRIA 864 R +P+CT ++ +S +PT P R +CC +R++ Sbjct: 208 RVIVPSCTVVRASSFTPTKVKPTLRVKCCTTRVS 241 >gi|16128566|ref|NP_415115.1| (NC_000913) enterochelin synthetase, component D [Escherichia coli K12] gi|1169536|sp|P19925|ENTD_ECOLI 4'-phosphopantetheinyl transferase entD (Enterobactin synthetase component D) (Enterochelin synthase D) gi|7465841|pir||E64791 enterobactin synthetase component D - Escherichia coli gi|1786797|gb|AAC73684.1| (AE000163) enterochelin synthetase, component D [Escherichia coli K12] Length = 209 Score = 31.2 bits (69), Expect = 4.8 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +2 Query: 35 EALLREGAAVQRLLTLTFSAKESLFKALYPQVRCYFDFLDARMVAVDTQR 184 E L G A LTL FSAKES FKA +++ FLD ++++ + Q+ Sbjct: 134 ERLADCGLAFSLALTLAFSAKESAFKA--SEIQTDAGFLDYQIISWNKQQ 181 >gi|15800297|ref|NP_286309.1| (NC_002655) enterobactin synthetase component D [Escherichia coli O157:H7 EDL933] gi|15829876|ref|NP_308649.1| (NC_002695) enterochelin synthetase, component D [Escherichia coli O157:H7] gi|22001586|sp|Q8XBW8|ENTD_ECO57 4'-phosphopantetheinyl transferase entD (Enterobactin synthetase component D) (Enterochelin synthase D) gi|12513472|gb|AAG54917.1|AE005238_3 (AE005238) enterobactin synthetase component D [Escherichia coli O157:H7 EDL933] gi|13360080|dbj|BAB34045.1| (AP002552) enterochelin synthetase, component D [Escherichia coli O157:H7] Length = 209 Score = 31.2 bits (69), Expect = 4.8 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +2 Query: 35 EALLREGAAVQRLLTLTFSAKESLFKALYPQVRCYFDFLDARMVAVDTQR 184 E L G A LTL FSAKES FKA +++ FLD ++++ + Q+ Sbjct: 134 ERLADCGLAFSLALTLAFSAKESAFKA--SEIQTDAGFLDYQIISWNKQQ 181 >gi|6018425|emb|CAB57861.1| (X17426) enterobactin [Escherichia coli] Length = 209 Score = 31.2 bits (69), Expect = 4.8 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +2 Query: 35 EALLREGAAVQRLLTLTFSAKESLFKALYPQVRCYFDFLDARMVAVDTQR 184 E L G A LTL FSAKES FKA +++ FLD ++++ + Q+ Sbjct: 134 ERLADCGLAFSLALTLAFSAKESAFKA--SEIQTDAGFLDYQIISWNKQQ 181 >gi|78421|pir||JV0078 entD protein - Escherichia coli gi|1651241|dbj|BAA35224.1| (D90700) EntD protein. [Escherichia coli] Length = 215 Score = 31.2 bits (69), Expect = 4.8 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +2 Query: 35 EALLREGAAVQRLLTLTFSAKESLFKALYPQVRCYFDFLDARMVAVDTQR 184 E L G A LTL FSAKES FKA +++ FLD ++++ + Q+ Sbjct: 140 ERLADCGLAFSLALTLAFSAKESAFKA--SEIQTDAGFLDYQIISWNKQQ 187 >gi|1778499|gb|AAB40782.1| (U82598) enterobactin synthetase component D [Escherichia coli] Length = 256 Score = 31.2 bits (69), Expect = 4.8 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +2 Query: 35 EALLREGAAVQRLLTLTFSAKESLFKALYPQVRCYFDFLDARMVAVDTQR 184 E L G A LTL FSAKES FKA +++ FLD ++++ + Q+ Sbjct: 181 ERLADCGLAFSLALTLAFSAKESAFKA--SEIQTDAGFLDYQIISWNKQQ 228 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Aug 28, 2002 2:02 AM Number of letters in database: 328,747,273 Number of sequences in database: 1,039,285 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 129,273,726 Number of Sequences: 1039285 Number of extensions: 2568117 Number of successful extensions: 8041 Number of sequences better than 10.0: 80 Number of HSP's better than 10.0 without gapping: 7726 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8035 length of database: 88,091,237 effective HSP length: 112 effective length of database: 55,707,557 effective search space used: 10584435830 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)