BLASTX 2.2.3 [Apr-24-2002]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1030631336-05970-8432 Query= 10H1_131_132BLASTX (909 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,039,285 sequences; 328,747,273 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports Score E Sequences producing significant alignments: (bits) Value gi|4150886|emb|CAA70528.1| (Y09356) isochorismate synthase ... 90 1e-17 gi|11992028|gb|AAG42414.1|AF302798_1 (AF302798) isochorisma... 75 4e-13 gi|17988421|ref|NP_541054.1| (NC_003318) ISOCHORISMATE SYNT... 73 1e-12 gi|16759554|ref|NP_455171.1| (NC_003198) isochorismate synt... 73 1e-12 gi|16763972|ref|NP_459587.1| (NC_003197) isochorismate synt... 73 1e-12 gi|1778510|gb|AAB40793.1| (U82598) isochorismate synthase [... 72 2e-12 gi|15800308|ref|NP_286320.1| (NC_002655) isochorismate hydr... 72 2e-12 gi|145840|gb|AAA18491.1| (M36700) iron chelator protein [Es... 72 2e-12 gi|22126465|ref|NP_669888.1| (NC_004088) yersiniabactin bio... 70 7e-12 gi|16121850|ref|NP_405163.1| (NC_003143) putative phosphopa... 70 7e-12 gi|152734|gb|AAA26516.1| (M63306) entC [Shigella flexneri] 70 9e-12 gi|5731363|gb|AAD48884.1| (U52150) phosphopantetheinyl tran... 54 5e-07 gi|15640799|ref|NP_230429.1| (NC_002505) vibriobactin synth... 54 5e-07 gi|13236172|gb|AAK16071.1|AF288077_4 (AF288077) NrgA [Photo... 54 7e-07 gi|11065902|gb|AAG28384.1|AF191324_1 (AF191324) phosphopant... 53 1e-06 gi|16080252|ref|NP_391079.1| (NC_000964) isochorismate synt... 52 3e-06 gi|21400238|ref|NP_656223.1| (NC_003995) chorismate_bind, c... 50 8e-06 gi|11127896|gb|AAG31127.1|AF299336_4 (AF299336) MxcD [Stigm... 47 1e-04 gi|113718|sp|P23300|AMOA_AERHY Putative isochorismate synth... 44 5e-04 gi|97020|pir||A40365 siderophore biosynthetic protein amoA ... 44 5e-04 gi|17988425|ref|NP_541058.1| (NC_003318) ENTEROBACTIN SYNTH... 44 0.001 gi|15619030|gb|AAL02537.1| (AF302798) EntD [Brucella melite... 44 0.001 gi|15596362|ref|NP_249856.1| (NC_002516) hypothetical prote... 41 0.005 gi|12003275|gb|AAG43513.1|AF210311_2 (AF210311) phosphopant... 38 0.039 gi|15890566|ref|NP_356238.1| (NC_003063) AGR_L_205GMp [Agro... 37 0.088 gi|21224969|ref|NP_630748.1| (NC_003888) conserved hypothet... 36 0.20 gi|223154|prf||0601198A polymerase beta,RNA [Escherichia coli] 35 0.26 gi|8050836|gb|AAF71762.1|AF263912_1 (AF263912) NysF [Strept... 35 0.26 gi|22001583|sp|Q54153|ENTD_SHIFL 4'-phosphopantetheinyl tra... 35 0.33 gi|15610351|ref|NP_217731.1| (NC_000962) entC [Mycobacteriu... 34 0.74 gi|1654413|gb|AAB17877.1| (U75434) Nsh-OrfC [Streptomyces a... 33 1.7 gi|7330732|gb|AAF60220.1|AF156879_1 (AF156879) (R)-specific... 32 2.8 gi|15827353|ref|NP_301616.1| (NC_002677) putative isochoris... 32 2.8 gi|16128566|ref|NP_415115.1| (NC_000913) enterochelin synth... 31 4.8 gi|15800297|ref|NP_286309.1| (NC_002655) enterobactin synth... 31 4.8 gi|6018425|emb|CAB57861.1| (X17426) enterobactin [Escherich... 31 4.8 gi|78421|pir||JV0078 entD protein - Escherichia coli >gi|16... 31 4.8 gi|1778499|gb|AAB40782.1| (U82598) enterobactin synthetase ... 31 4.8 gi|17547095|ref|NP_520497.1| (NC_003295) PUTATIVE FERREDOXI... 31 6.3 gi|2145977|pir||S72803 thioredoxin trxA - Mycobacterium lep... 31 6.3
Alignments
>gi|4150886|emb|CAA70528.1| (Y09356) isochorismate synthase [Pseudomonas fluorescens] Length = 391 Score = 89.7 bits (221), Expect = 1e-17 Identities = 49/116 (42%), Positives = 68/116 (58%), Gaps = 3/116 (2%) Frame = +3 Query: 570 QSTFLYRSEFRSLSADGVFERIETPAFGGEQEGSALAQHIRQALARAKAAGQETPVVVGA 749 Q +F + S R L+ G+ +RIETPA GG+ S Q I QAL RA+ AGQ P++VGA Sbjct: 20 QRSFSFTSGDRELAVTGMLQRIETPAIGGDDANSLFQQTIAQALDRAREAGQSNPIIVGA 79 Query: 750 IPFDTRRPSCLYVPENCQFVANDSFTR---AARPMLQQPHRLAACTAFRTNALKHA 908 IPFD PSCLY+PE+ Q+ D + + P L + + AF+ A++HA Sbjct: 80 IPFDPAEPSCLYIPEHAQWRTRDIHAKTGMSTLPELIEQKNIPDEQAFK-RAVEHA 134 >gi|11992028|gb|AAG42414.1|AF302798_1 (AF302798) isochorismate synthase [Brucella melitensis biovar Abortus] Length = 427 Score = 74.7 bits (182), Expect = 4e-13 Identities = 46/113 (40%), Positives = 59/113 (51%), Gaps = 3/113 (2%) Frame = +3 Query: 579 FLYRSEFRSLSADGVFERIETPAFGGEQEGSALAQHIRQALARAKAAGQETPVVVGAIPF 758 F + S L+A G+ E I TPA GG S + I QA RA AGQ P+VVGAIPF Sbjct: 23 FSFSSGNLKLAASGMREVIATPAIGGSNPDSTFQRAIAQAFERAARAGQRNPIVVGAIPF 82 Query: 759 DTRRPSCLYVPENCQFVAND---SFTRAARPMLQQPHRLAACTAFRTNALKHA 908 D PSCLYVPE + + + AA P L + F+ +A++HA Sbjct: 83 DPGEPSCLYVPEEMDWQEREPASGASAAAMPQLAGQRSVPDEAGFK-HAVEHA 134 >gi|17988421|ref|NP_541054.1| (NC_003318) ISOCHORISMATE SYNTHASE DHBC [Brucella melitensis] gi|17984204|gb|AAL53318.1| (AE009646) ISOCHORISMATE SYNTHASE DHBC [Brucella melitensis] Length = 418 Score = 73.2 bits (178), Expect = 1e-12 Identities = 45/113 (39%), Positives = 59/113 (51%), Gaps = 3/113 (2%) Frame = +3 Query: 579 FLYRSEFRSLSADGVFERIETPAFGGEQEGSALAQHIRQALARAKAAGQETPVVVGAIPF 758 F + S L+A G+ + I TPA GG S + I QA RA AGQ P+VVGAIPF Sbjct: 50 FSFASGNLKLAASGMRKVIATPAIGGSNPDSTFQRAIAQAFERAARAGQRNPIVVGAIPF 109 Query: 759 DTRRPSCLYVPENCQFVAND---SFTRAARPMLQQPHRLAACTAFRTNALKHA 908 D PSCLYVPE + + + AA P L + F+ +A++HA Sbjct: 110 DPGEPSCLYVPEEMDWQEREPASGASAAAMPQLAGQRSVPDEAGFK-HAVEHA 161 >gi|16759554|ref|NP_455171.1| (NC_003198) isochorismate synthase EntC [Salmonella enterica subsp. enterica serovar Typhi] gi|16501846|emb|CAD05071.1| (AL627267) isochorismate synthase EntC [Salmonella enterica subsp. enterica serovar Typhi] Length = 389 Score = 72.8 bits (177), Expect = 1e-12 Identities = 36/87 (41%), Positives = 48/87 (54%) Frame = +3 Query: 579 FLYRSEFRSLSADGVFERIETPAFGGEQEGSALAQHIRQALARAKAAGQETPVVVGAIPF 758 F + S +RS + G F R PA G+ S Q +RQ A AK+ G P++VGAIPF Sbjct: 19 FFFMSPYRSFTTSGCFARYTEPAVAGDSPDSPFQQKLRQQFAEAKSQGIANPILVGAIPF 78 Query: 759 DTRRPSCLYVPENCQFVANDSFTRAAR 839 DTR+PS L++P Q + R AR Sbjct: 79 DTRQPSSLFIPMAWQSFSRQQKQRTAR 105 >gi|16763972|ref|NP_459587.1| (NC_003197) isochorismate synthetase, enterochelin biosynthesis [Salmonella typhimurium LT2] gi|16419105|gb|AAL19546.1| (AE008723) isochorismate synthetase, enterochelin biosynthesis [Salmonella typhimurium LT2] Length = 391 Score = 72.8 bits (177), Expect = 1e-12 Identities = 36/87 (41%), Positives = 48/87 (54%) Frame = +3 Query: 579 FLYRSEFRSLSADGVFERIETPAFGGEQEGSALAQHIRQALARAKAAGQETPVVVGAIPF 758 F + S +RS + G F R PA G+ S Q +RQ A AK+ G P++VGAIPF Sbjct: 21 FFFMSPYRSFTTSGCFARYTEPAVAGDSPDSPFQQKLRQQFAEAKSQGIANPILVGAIPF 80 Query: 759 DTRRPSCLYVPENCQFVANDSFTRAAR 839 DTR+PS L++P Q + R AR Sbjct: 81 DTRQPSSLFIPMAWQSFSRQQKQRTAR 107 >gi|1778510|gb|AAB40793.1| (U82598) isochorismate synthase [Escherichia coli] Length = 395 Score = 72.4 bits (176), Expect = 2e-12 Identities = 36/87 (41%), Positives = 49/87 (55%) Frame = +3 Query: 579 FLYRSEFRSLSADGVFERIETPAFGGEQEGSALAQHIRQALARAKAAGQETPVVVGAIPF 758 F + S +RS + G F R + PA G+ S Q + A AKA G + PV+VGAIPF Sbjct: 25 FFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAALFADAKAQGIKNPVMVGAIPF 84 Query: 759 DTRRPSCLYVPENCQFVANDSFTRAAR 839 D R+PS LY+PE+ Q + +AR Sbjct: 85 DPRQPSSLYIPESWQSFSRQEKQASAR 111 >gi|15800308|ref|NP_286320.1| (NC_002655) isochorismate hydroxymutase 2, enterochelin biosynthesis [Escherichia coli O157:H7 EDL933] gi|15829886|ref|NP_308659.1| (NC_002695) isochorismate hydroxymutase 2 [Escherichia coli O157:H7] gi|16128576|ref|NP_415125.1| (NC_000913) isochorismate hydroxymutase 2, enterochelin biosynthesis [Escherichia coli K12] gi|585097|sp|P10377|ENTC_ECOLI Isochorismate synthase entC (Isochorismate mutase) gi|68479|pir||SYECIK isochorismate synthase (EC 5.4.99.6) [validated] - Escherichia coli gi|450376|gb|AAA16100.1| (M24142) isochorismate synthase [Escherichia coli] gi|1786809|gb|AAC73694.1| (AE000165) isochorismate hydroxymutase 2, enterochelin biosynthesis [Escherichia coli K12] gi|12513486|gb|AAG54928.1|AE005239_3 (AE005239) isochorismate hydroxymutase 2, enterochelin biosynthesis [Escherichia coli O157:H7 EDL933] gi|13360090|dbj|BAB34055.1| (AP002552) isochorismate hydroxymutase 2 [Escherichia coli O157:H7] Length = 391 Score = 72.4 bits (176), Expect = 2e-12 Identities = 36/87 (41%), Positives = 49/87 (55%) Frame = +3 Query: 579 FLYRSEFRSLSADGVFERIETPAFGGEQEGSALAQHIRQALARAKAAGQETPVVVGAIPF 758 F + S +RS + G F R + PA G+ S Q + A AKA G + PV+VGAIPF Sbjct: 21 FFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAALFADAKAQGIKNPVMVGAIPF 80 Query: 759 DTRRPSCLYVPENCQFVANDSFTRAAR 839 D R+PS LY+PE+ Q + +AR Sbjct: 81 DPRQPSSLYIPESWQSFSRQEKQASAR 107 >gi|145840|gb|AAA18491.1| (M36700) iron chelator protein [Escherichia coli] Length = 391 Score = 72.4 bits (176), Expect = 2e-12 Identities = 36/87 (41%), Positives = 49/87 (55%) Frame = +3 Query: 579 FLYRSEFRSLSADGVFERIETPAFGGEQEGSALAQHIRQALARAKAAGQETPVVVGAIPF 758 F + S +RS + G F R + PA G+ S Q + A AKA G + PV+VGAIPF Sbjct: 21 FFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAALFADAKAQGIKNPVMVGAIPF 80 Query: 759 DTRRPSCLYVPENCQFVANDSFTRAAR 839 D R+PS LY+PE+ Q + +AR Sbjct: 81 DPRQPSSLYIPESWQSFSRQEKQASAR 107 >gi|22126465|ref|NP_669888.1| (NC_004088) yersiniabactin biosynthesis component [Yersinia pestis KIM] gi|21959458|gb|AAM86139.1|AE013860_5 (AE013860) yersiniabactin biosynthesis component [Yersinia pestis KIM] Length = 218 Score = 70.5 bits (171), Expect = 7e-12 Identities = 39/87 (44%), Positives = 52/87 (58%), Gaps = 1/87 (1%) Frame = +2 Query: 2 ELWGDRFGGGREALLREGAA-VQRLLTLTFSAKESLFKALYPQVRCYFDFLDARMVAVDT 178 E+W +LL++G + LTL FSAKESLFKA+YPQ YFDF++AR+++ Sbjct: 119 EIWSGIISDEEYSLLQQGPLPFNQALTLVFSAKESLFKAVYPQSGRYFDFIEARLLSYSL 178 Query: 179 QRQTFVLALLKTLTPNCPAGRRFNGRF 259 F L LL+ L PAGR F+G F Sbjct: 179 VSGNFELQLLRHLNDEFPAGRCFSGCF 205 >gi|16121850|ref|NP_405163.1| (NC_003143) putative phosphopantetheinyl transferase [Yersinia pestis] gi|15979620|emb|CAC90402.1| (AJ414149) putative phosphopantetheinyl transferase [Yersinia pestis] Length = 246 Score = 70.5 bits (171), Expect = 7e-12 Identities = 39/87 (44%), Positives = 52/87 (58%), Gaps = 1/87 (1%) Frame = +2 Query: 2 ELWGDRFGGGREALLREGAA-VQRLLTLTFSAKESLFKALYPQVRCYFDFLDARMVAVDT 178 E+W +LL++G + LTL FSAKESLFKA+YPQ YFDF++AR+++ Sbjct: 147 EIWSGIISDEEYSLLQQGPLPFNQALTLVFSAKESLFKAVYPQSGRYFDFIEARLLSYSL 206 Query: 179 QRQTFVLALLKTLTPNCPAGRRFNGRF 259 F L LL+ L PAGR F+G F Sbjct: 207 VSGNFELQLLRHLNDEFPAGRCFSGCF 233 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Aug 28, 2002 2:02 AM Number of letters in database: 328,747,273 Number of sequences in database: 1,039,285 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 129,273,726 Number of Sequences: 1039285 Number of extensions: 2568117 Number of successful extensions: 8041 Number of sequences better than 10.0: 80 Number of HSP's better than 10.0 without gapping: 7726 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8035 length of database: 88,091,237 effective HSP length: 112 effective length of database: 55,707,557 effective search space used: 10584435830 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)